IdeS Protein, Streptococcus pyogenes (His)

IdeS Protein is a highly specific IgG endopeptidase evolved from Streptococcus pyogenes, which can degrade IgG and participate in the immune response. IdeS Protein inhibits the function of certain neutrophil effectors, namely the production of reactive oxygen species (ROS), independently of IgG endopeptidase activity. IdeS Protein, Streptococcus pyogenes (His) is the recombinant IdeS protein, expressed by E. coli , with N-10*His labeled tag.

IdeS is a highly specific IgG endopeptidase evolved from Streptococcus pyogenes, which can not only degrade IgG but also directly or indirectly inhibit the innate immune response, thus promoting the survival of streptococcus in the inflammatory environment. IdeS was found to be identical to Mac-1 in Streptococcus, a protein thought to inhibit phagocytosis by inhibiting the recognition of IgG and/or complement configurations by the Fc receptor (CD16). IdeS/Mac-1 can inhibit the function of certain neutrophil effectors, namely the production of reactive oxygen species (ROS), independently of IgG endopeptidase activity^[1][2].

Measured by its ability to cleave human IgG. The DC₅₀ is <50 ng, as measured under the described conditions.
The DC₅₀ is defined as the amount of enzyme required to cleave 50% of 1 μg human IgG in 30 minutes at 37 °C. Use of Recombinant S.pyogenes IdeS in the cleavage of other IgGs may require alternative conditions for optimal performance.

Others

E. coli

N-10*His

F8V4V0 (D30-N341)

/

Full Length of Mature Protein

DSFSANQEIRYSEVTPYHVTSVWTKGVTPPAKFTQGEDVFHAPYVANQGWYDITKTFNGKDDLLCGAATAGNMLHWWFDQNKEKIEAYLKKHPDKQKIMFGDQELLDVRKVINTKGDQTNSELFNYFRDKAFPGLSARRIGVMPDLVLDMFINGYYLNVYKTQTTDVNRTYQEKDRRGGIFDAVFTRGDQSKLLTSRHDFKEKNLKEISDLIKKELTEGKALGLSHTYANVRINHVINLWGADFDSNGNLKAIYVTDSDSNASIGMKKYFVGVNSAGKVAISAKEIKEDNIGAQVLGLFTLSTGQDSWNQTN

Approximately 34 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. von Pawel-Rammingen U. Streptococcal IdeS and its impact on immune response and inflammation. J Innate Immun. 2012;4(2):132-40.  [Content Brief]

  [2]. Shin JI, et al. Anti-glomerular basement membrane disease (Goodpasture disease): From pathogenesis to plasma exchange to IdeS. Ther Apher Dial. 2022 Feb;26(1):24-31.  [Content Brief]