IFI27L2A Protein, Mouse (Cell-Free, His)

The IFI27L2A protein critically regulates interferon-induced transcriptional activity, specifically NR4A1, NR4A2, and NR4A3. Its interaction with XPO1 enhances the nuclear export of these receptors, with potential vascular effects on the injury response. IFI27L2A Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived IFI27L2A protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of IFI27L2A Protein, Mouse (Cell-Free, His) is 66 a.a., with molecular weight of 7.3 kDa.

IFI27L2A Protein appears to play a crucial role in the interferon-induced negative regulation of transcriptional activity associated with NR4A1, NR4A2, and NR4A3, achieved by enhancing the XPO1-mediated nuclear export of these nuclear receptors. This interaction suggests a potential involvement in mediating cellular responses, particularly in the vascular context where the regulation of NR4A1 transcriptional activity may contribute to the response to injury. The homodimeric nature of IFI27L2A, along with its interactions with SKP2, NR4A1, and potentially BCL2, further underscores its multifaceted roles in cellular processes, emphasizing its significance in the intricate regulatory networks governing gene expression and cellular responses. Unraveling the detailed mechanisms by which IFI27L2A orchestrates these interactions could provide valuable insights into its functional significance and potential implications in various biological contexts.

Mouse

E. coli Cell-free

N-10*His

Q8R412 (A25-L90)

76933

AMGFTGTGIAAASIAAKMMSAAAIANGGGVAAGSLVATLQSAGVLGLSTSTNAILGAAGAAVGALL

7.3 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.