IFI27L2A Protein, Mouse (Cell-Free, His)
Based on 1 Customer Validation
The IFI27L2A protein critically regulates interferon-induced transcriptional activity, specifically NR4A1, NR4A2, and NR4A3. Its interaction with XPO1 enhances the nuclear export of these receptors, with potential vascular effects on the injury response. IFI27L2A Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived IFI27L2A protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
- Species: Mouse
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The IFI27L2A protein critically regulates interferon-induced transcriptional activity, specifically NR4A1, NR4A2, and NR4A3. Its interaction with XPO1 enhances the nuclear export of these receptors, with potential vascular effects on the injury response. IFI27L2A Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived IFI27L2A protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
Background
IFI27L2A Protein appears to play a crucial role in the interferon-induced negative regulation of transcriptional activity associated with NR4A1, NR4A2, and NR4A3, achieved by enhancing the XPO1-mediated nuclear export of these nuclear receptors. This interaction suggests a potential involvement in mediating cellular responses, particularly in the vascular context where the regulation of NR4A1 transcriptional activity may contribute to the response to injury. The homodimeric nature of IFI27L2A, along with its interactions with SKP2, NR4A1, and potentially BCL2, further underscores its multifaceted roles in cellular processes, emphasizing its significance in the intricate regulatory networks governing gene expression and cellular responses. Unraveling the detailed mechanisms by which IFI27L2A orchestrates these interactions could provide valuable insights into its functional significance and potential implications in various biological contexts.
Technical Parameters
-
Species Mouse
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
Q8R412 (A25-L90)
-
Gene ID76933
-
Molecular Construction
-
N-term
-
10*His
-
IFI27L2A (A25-L90)
Accession # Q8R412 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Interferon alpha-inducible protein 27-like protein 2A; Interferon-stimulated gene 12 protein; ISG12; Ifi27l2a; Ifi27; Isg12
-
AA Sequence
AMGFTGTGIAAASIAAKMMSAAAIANGGGVAAGSLVATLQSAGVLGLSTSTNAILGAAGAAVGALL
-
Predicted Molecular Mass
7.3 kDa
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 0.05% FOS12, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
