IFN-alpha 1/IFNA1 Protein, Human (HEK293, His)

IFN-alpha 1 (IFNA1), belongs to type I interferon family, is produced by macrophages with antiviral activities^[1]. IFN-alpha 1 involves in the activation of JAK1 and TYK2 pathway^[4], exerts function by inhibiting viral replication as well as modulating immune response^[3]. IFN-alpha 1/IFNA1 Protein, Human (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag.

IFN-alpha 1 (IFNA1; IFN-α1), belongs to the alpha/beta interferon family, is produced by macrophages with antiviral activities^[1]. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively^[2].
IFNs binds to one of three type-specific receptors, which leads to the activation of JAK1 and TYK2^[3]. This signal transduction results in phosphorylation of STAT1 and STAT2 and eventually in an association with IFN regulatory factor 9 (IRF9) and formation of the IFN-stimulated gene factor 3 (ISGF3) complex. Thus the ISGF3 complex induces transcription of IFN-stimulated genes (ISGs), with subsequent immunomodulatory effects on both innate and adaptive immune responses^[4].
The interactions of type I IFN with the immune system is important for the generation of a durable antitumor response through its effects on dendritic cells (DC)^[5]. IFN has been widely used for animal disease model, and the sequence of amino acids in IFNA1 protein of human is very different from mouse (62.96%).

IFN-alpha induces highly active dendritic cells (DC) rapidly generated from blood monocytes in vitro, suitable for therapeutic vaccination of cancer research^[5].

Measured by its ability to inhibit the proliferation of TF-1 human erythroleukemic cells. The ED₅₀ this effect is 0.327 ng/mL, corresponding to a specific activity is 3.058×10⁶ units/mg.

• 
  Measured by its ability to inhibit the proliferation of TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 0.327 ng/mL, corresponding to a specific activity is 3.058×10⁶ units/mg.

Human

HEK293

C-6*His

P01562 (C24-E189)

3439  [NCBI]

CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

17-20 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB,150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Zoon KC, et al. Purification and characterization of multiple components of human lymphoblastoid interferon-alpha. J Biol Chem. 1992 Jul 25;267(21):15210-6.  [Content Brief]

  [2]. Zhang SY, et al. Inborn errors of interferon (IFN)-mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40.  [Content Brief]

  [3]. Gibbert K, et al. IFN-α subtypes: distinct biological activities in anti-viral therapy. Br J Pharmacol. 2013 Mar;168(5):1048-58.  [Content Brief]

  [4]. De Ceuninck F, et al. IFN-α: A key therapeutic target for multiple autoimmune rheumatic diseases. Drug Discov Today. 2021 Oct;26(10):2465-2473.  [Content Brief]

  [5]. Lapenta C, et al. IFN-Alpha-Mediated Differentiation of Dendritic Cells for Cancer Immunotherapy: Advances and Perspectives. Vaccines (Basel). 2020 Oct 19;8(4):617.  [Content Brief]