Copy Link Print Information

IFN-alpha 1/IFNA13 Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

IFN-alpha 1 (IFNA1), belongs to type I interferon family, is produced by macrophages with antiviral activities. IFN-alpha 1 involves in the activation of JAK1 and TYK2 pathway, exerts function by inhibiting viral replication as well as modulating immune response. IFN-alpha 1/IFNA13 Protein, Human (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IFN-alpha 1/IFNA13 Protein, Human (HEK293, His)
  • IFN-alpha 1/IFNA13 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IFN-alpha 1 (IFNA1), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 1 involves in the activation of JAK1 and TYK2 pathway[4], exerts function by inhibiting viral replication as well as modulating immune response[3]. IFN-alpha 1/IFNA13 Protein, Human (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag.

Background

IFN-alpha 1 (IFNA1; IFN-α1), belongs to the alpha/beta interferon family, is produced by macrophages with antiviral activities[1]. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[2].
IFNs binds to one of three type-specific receptors, which leads to the activation of JAK1 and TYK2[3]. This signal transduction results in phosphorylation of STAT1 and STAT2 and eventually in an association with IFN regulatory factor 9 (IRF9) and formation of the IFN-stimulated gene factor 3 (ISGF3) complex. Thus the ISGF3 complex induces transcription of IFN-stimulated genes (ISGs), with subsequent immunomodulatory effects on both innate and adaptive immune responses[4].
The interactions of type I IFN with the immune system is important for the generation of a durable antitumor response through its effects on dendritic cells (DC)[5]. IFN has been widely used for animal disease model, and the sequence of amino acids in IFNA1 protein of human is very different from mouse (62.96%).

In Vitro

IFN-alpha induces highly active dendritic cells (DC) rapidly generated from blood monocytes in vitro, suitable for therapeutic vaccination of cancer research[5].

Verified Bioactivity

1. Measured by its ability to inhibit the proliferation of TF-1 human erythroleukemic cells. The ED50 this effect is 0.327 ng/mL, corresponding to a specific activity is 3.058×106 units/mg.
2. Human IFN-alpha 1 immobilized on CM5 Chip can bind IFNAR2 with an affinity constant of 19.04 nM as determined in a SPR assay.
3. Measured by its ability to inhibit the proliferation of Daudi cells. The ED50 for this effect is 1.543 ng/mL, corresponding to a specific activity is 6.481×105 Unit/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P01562 (C24-E189)

  • Gene ID
    3439  [NCBI]/3447  [NCBI]
  • Molecular Construction
    • N-term
    • IFNA1 (C24-E189)
      Accession # P01562
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IFNA1; Interferon Alpha-1; Interferon Alpha 1; Interferon Alpha-D; IFN-AlphaD; Interferon-Alpha1; IFN-ALPHA; IFN-Alpha-1; IFNA13; LeIF D; IFNA@; Interferon Alpha-1/13; IFL; IFN-Alpha-1/13; IFN; IFN-Alpha 1b; Interferon Alpha 1b

  • AA Sequence

    CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

  • Predicted Molecular Mass

    20.2 kDa

  • Molecular Weight

    Approximately 17-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Zoon KC, et al. Purification and characterization of multiple components of human lymphoblastoid interferon-alpha. J Biol Chem. 1992 Jul 25;267(21):15210-6. [Content Brief]

[2]. Zhang SY, et al. Inborn errors of interferon (IFN)-mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40. [Content Brief]

[3]. Gibbert K, et al. IFN-α subtypes: distinct biological activities in anti-viral therapy. Br J Pharmacol. 2013 Mar;168(5):1048-58. [Content Brief]

[4]. De Ceuninck F, et al. IFN-α: A key therapeutic target for multiple autoimmune rheumatic diseases. Drug Discov Today. 2021 Oct;26(10):2465-2473. [Content Brief]

[5]. Lapenta C, et al. IFN-Alpha-Mediated Differentiation of Dendritic Cells for Cancer Immunotherapy: Advances and Perspectives. Vaccines (Basel). 2020 Oct 19;8(4):617. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • IFN-alpha 1/IFNA13 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for IFN-alpha 1/IFNA13 Protein, Human (HEK293, His)
  • IFN-alpha 1/IFNA13 Protein, Human (HEK293, His) Product Image