1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-alpha
  5. IFN-alpha 14
  6. IFN-alpha 14/IFNA14 Protein, Mouse (HEK293, His)

IFN-alpha 14/IFNA14 Protein, Mouse (HEK293, His)

Cat. No.: HY-P76401
Handling Instructions Technical Support

IFN-alpha 14 (IFNA14), belongs to type I interferon family, is produced by macrophages with antiviral activities. IFN-alpha 14/IFNA14 Protein, Mouse (HEK293, His) contains 166 a.a. (C24-K189), produced in HEK293 cells with a C-terminal His-tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg Get quote
5 μg Get quote
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-alpha 14 (IFNA14), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 14/IFNA14 Protein, Mouse (HEK293, His) contains 166 a.a. (C24-K189), produced in HEK293 cells with a C-terminal His-tag.

Background

IFN-alpha 14 (IFNA14; IFN-α14), belongs to the alpha/beta interferon (IFN) family, is produced by the macrophages with antiviral activities[1]. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[2].
Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Interferon alpha (IFNa) shows significant biological activity in various cancers, paticularly haematological malignancies such as hairy cell leukaemia and chronic myelogenous leukaemia[3].
IFN-alpha 14 involves in JAK/STAT signaling pathway, is identified as potent regulators that reduces both CTLA4 and FOXP3. Therefore, regulatory T cells (Tregs) as the key cells regulating peripheral autoreactive T lymphocytes, IFNα-14 regulates Treg functional states and destabilises Treg[4].
IFN-alpha14 is a new gene found in tissues of uninfected mice, also found to lack N-glycosylation and have its expression induced in response to viral infection in contrast to IFN-alpha 13[5].

Biological Activity

Measured in antiviral assay using L929 cells infected with vesicular stomatitisvirus (VSV) and the ED50 is typically 5-40 pg/mL.

Species

Mouse

Source

HEK293

Tag

C-10*His

Accession

Q810G3 (C24-K189)

Gene ID
Molecular Construction
N-term
IFNA14 (C24-K189)
Accession # Q810G3
10*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interferon alpha-14; Interferon alpha-H; LeIF H; Interferon lambda-2-H; IFNA14
AA Sequence

CDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILTLFTSKDSSAAWDATLLDSFCNDLNTQLNDLQGCLMQQVEIQAPPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEIWRALSSSAKLLTSLKEEK

Predicted Molecular Mass
20.5 kDa
Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

IFN-alpha 14/IFNA14 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IFN-alpha 14/IFNA14 Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-alpha 14/IFNA14 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P76401
Quantity:
MCE Japan Authorized Agent: