IFN-alpha/beta R2 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
IFN-α/β R2 protein and IFNAR1 together constitute the heterodimeric receptor of type I interferon and initiate the JAK-STAT signaling cascade. Upon binding of type I interferons, IFNAR1 and IFNAR2 activate related Janus kinases (TYK2 and JAK1) in proximity, resulting in cross-phosphorylation. IFN-alpha/beta R2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IFN-alpha/beta R2 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IFN-α/β R2 protein and IFNAR1 together constitute the heterodimeric receptor of type I interferon and initiate the JAK-STAT signaling cascade. Upon binding of type I interferons, IFNAR1 and IFNAR2 activate related Janus kinases (TYK2 and JAK1) in proximity, resulting in cross-phosphorylation. IFN-alpha/beta R2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IFN-alpha/beta R2 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The IFN-alpha/beta R2 Protein, in conjunction with IFNAR1, constitutes the heterodimeric receptor for type I interferons, encompassing interferons alpha, beta, epsilon, omega, and kappa. Upon type I interferon binding, the receptor activation initiates the JAK-STAT signaling cascade, leading to the transcriptional activation or repression of interferon-regulated genes that mediate the interferon response. Mechanistically, the binding of type I interferon brings IFNAR1 and IFNAR2 into close proximity, facilitating cross-phosphorylation of their associated Janus kinases (JAKs), with TYK2 bound to IFNAR1 and JAK1 bound to IFNAR2. The activated JAKs then phosphorylate specific tyrosine residues on the intracellular domains of IFNAR1 and IFNAR2, creating docking sites for STAT transcription factors (STAT1, STAT2, and STAT). These phosphorylated STAT proteins translocate into the nucleus, regulating the expression of interferon-regulated genes. Additionally, IFN-alpha/beta R2 proteins may function as potent inhibitors of type I interferon receptor activity, showcasing their role in modulating the interferon signaling pathway.
Verified Bioactivity
Immobilized Mouse IFNA2 at 10 μg/mL (100 μL/well) can bind IFNAR2. The ED50 for this effect is 126.3 ng/mL.
MCE Validation Data
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
O35664-1 (S22-A242)
-
Molecular Construction
-
N-term
-
IFNAR2 (S22-A242)
Accession # O35664-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
IFNAR2; IFN-R-2; Prev. IFNABR; Interferon-Alpha/Beta Receptor Beta Chain; Interferon Alpha/Beta Receptor 2; Human Interferon Alpha/Beta Receptor; Type I Interferon Receptor 2; IFN-Alpha Binding Protein; Interferon (Alpha, Beta And Omega) Receptor 2; Inter
-
AA Sequence
SLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSESA
-
Molecular Weight
Approximately 45-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
