IFN-beta Protein, Human (HEK293, Fc)

IFN-β (interferon-β) is a key type I interferon cytokine that coordinates the innate immune response to infection, tumors, and inflammation. IFN-β binds to high-affinity (IFNAR2) and low-affinity (IFNAR1) heterodimeric receptors, activates Jak-STAT signaling, and modulates interferon-regulated genes. IFN-beta Protein, Human (HEK293, Fc) is the recombinant human-derived IFN-beta protein, expressed by HEK293 , with C-hFc labeled tag.

IFN-beta (Interferon-beta), a pivotal type I interferon cytokine, assumes a critical role in orchestrating the innate immune response to various challenges, including infections, tumor development, and inflammatory stimuli. Acting through a high-affinity (IFNAR2) and low-affinity (IFNAR1) heterodimeric receptor, IFN-beta triggers the canonical Jak-STAT signaling pathway, leading to the transcriptional activation or repression of interferon-regulated genes. These genes, in turn, encode effectors crucial for the interferon response, encompassing antiviral proteins, regulators of cell proliferation and differentiation, and immunoregulatory proteins. While primarily signaling through the IFNAR1-IFNAR2 heterodimeric receptor, IFN-beta also demonstrates versatility by functioning with IFNAR1 alone and operating independently of Jak-STAT pathways. Its multifaceted effects span antiviral and antibacterial activities, modulation of B-cell development, myelopoiesis, and lipopolysaccharide-inducible production of tumor necrosis factor. In the realm of neuronal homeostasis, IFN-beta emerges as a guardian, regulating dopamine turnover and safeguarding dopaminergic neurons through the promotion of neuronal autophagy and alpha-synuclein clearance, thereby averting dopaminergic neuron loss. Notably, IFN-beta surpasses interferon-alpha (IFN-alpha) in potency, particularly in inducing apoptotic and antiproliferative pathways crucial for controlling tumor cell growth. Presenting as a monomer, IFN-beta embodies a versatile and potent player in diverse physiological responses and immune regulation.

Measured in antiviral assays using WISH human amnion cells infected with vesicular stomatitis virus (VSV) and the ED₅₀ is 0.08-0.8 ng/mL.

Human

HEK293

C-hFc

P01574 (M22-N187)

3456  [NCBI]

Full Length of Mature Protein

MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

Approximately 52 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, 10% trehalose, 0.02% Tween 80, pH 8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. /biology-dictionary/hela-cell.html  [Content Brief]