IFN-gamma Protein, Human

IFN-gamma Protein, human activates STAT signaling pathway and affects gene regulation. IFN-gamma Protein, human activates effector immune cells and enhances antigen presentation. IFN-gamma Protein, human also regulates the hematopoietic stem cells development. IFN-gamma Protein, human is the recombinant human-derived IFN-gamma Protein, expressed by E. coli.

Human Interferon-gamma (hIFNγ) is naturally produced by CD4⁺ T helper cell type 1 (Th1) lymphocytes, CD8⁺ cytotoxic lymphocytes, natural killer (NK) cells, B cells, NKT cells, and professional antigen-presenting cells (APCs). Secretion of hIFNγ by NK cells and APCs is important in early host reactions against infection while production of hIFNγ by T lymphocytes is important in the adaptive immune response. hIFNγ shows antiviral and antitumor activity and is involved in complex interactions of cellular metabolism and differentiation^[1]. Interferon-gamma (IFN-γ) is a cytokine with potent immunomodulatory propertiy. IFN-γ activates cells via a different receptor than IFN-α and IFN-β, which accounts for the different physiological properties of the proteins^[2].

IFN-gamma Protein (human, 0-1000 ng/mL, 12-18 h) induces IFN-γ-inducible protein-16 (IFI16) accumulation in A549 nucleus and cytoplasm^[3].
IFN-gamma Protein (human, 100 ng/mL, 24 h) promotes the PD-L1 expression, activates PI3K/Akt and ERK1/2 signaling pathways, increases the CD44+/CD24- cell ratio, and enhances cell sphere formation ability. IFN-gamma Protein promotes the stemness of breast cancer cell MCF-7^[4].

The ED₅₀ is <1 ng/mL as measured by its ability to inhibit the proliferation of HT-29 cells., corresponding to a specific activity of >1 × 10⁶ units/mg.

Human

E. coli

Tag Free

P01579 (Q24-Q166)

3458  [NCBI]

Full Length of Mature Protein

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 5 % trehalose, 5% mannitol, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, 5% trehalose, 5% mannitol, pH 7.4.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Razaghi A, et al. Review of the recombinant human interferon gamma as an immunotherapeutic: Impacts of production platforms and glycosylation. J Biotechnol. 2016 Dec 20;240:48-60.  [Content Brief]

  [2]. Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34(10):759-68.  [Content Brief]

  [3]. Jiang Z, et al., IFI16 directly senses viral RNA and enhances RIG-I transcription and activation to restrict influenza virus infection. Nat Microbiol. 2021 Jul;6(7):932-945.  [Content Brief]

  [4]. Gao L, et al., MiR-873/PD-L1 axis regulates the stemness of breast cancer cells. EBioMedicine. 2019 Mar;41:395-407.  [Content Brief]