IFN-omega 1 Protein, Human
Based on 1 Customer Validation
IFN-omega 1 Protein, Human has antiviral, anti-proliferation, and antitumor activities that are similar to those of IFN-α.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IFN-omega 1 Protein, Human has antiviral, anti-proliferation, and antitumor activities that are similar to those of IFN-α.
Background
Interferon-omega (IFN-omega), a type I interferon, is a monomeric glycoprotein distantly related in structure to IFN-alpha and IFN-beta, but unrelated to IFN-gamma. The human type I interferon receptor complex, which mediates the biological activity of IFN-alpha and IFN-beta, also binds IFN-omega. IFN-omega is secreted by virus-infected leukocytes. Human IFN-ω binds to the α/β receptor but not to the interferon γ receptor[1]. IFN-omega has antiviral function on hepatitis B virus replication in human hepatoma cells[2]. IFN-ω also has been explored as a treatment option for some diseases or viral infections in humans and other animals[3].
Verified Bioactivity
The ED50 is ≤0.01086 ng/mL as measured by human TF-1 cells, corresponding to a specific activity of ≥9.2 × 107 units/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P05000 (C24-S195)
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IFNW1; Interferon Alpha-II-1; Interferon Omega 1; Interferon Omega-1; IFN-Omega 1, Interferon Omega-1; Interferon 1BA1
-
AA Sequence
CDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS
-
Predicted Molecular Mass
20 kDa
-
Molecular Weight
Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Flores, et al. Human interferon omega (omega) binds to the alpha/beta receptor. J Biol Chem. 1991 Oct 25;266(30):19875-7. [Content Brief]
[2]. Hagelstein J, et al. Antiviral potential of interferon-omega on hepatitis B virus replication in human hepatoma cells. Arzneimittelforschung. 1998 Mar;48(3):343-7. [Content Brief]
[3]. Li SF, et al. Interferon-omega: Current status in clinical applications. Int Immunopharmacol. 2017 Nov;52:253-260. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)