1. Recombinant Proteins
  2. IFN-omega Protein, Human

IFN-omega Protein, Human

Cat. No.: HY-P7201
Handling Instructions

IFN-omega Protein, Human has antiviral, anti-proliferation, and antitumor activities that are similar to those of IFN-α.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $80 In-stock
Estimated Time of Arrival: December 31
50 μg $160 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuIFN-ω; Interferon omega-1; IFNW1
Species

Human

Source

E. coli

Accession

P05000 (C24-S195)

Gene ID

3467

Molecular Weight

Approximately 20.0 kDa

AA Sequence

CDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS

Biological Activity
The ED50 is <0.01 ng/mL as measured by human TF-1 cells, corresponding to a specific activity of >1.0 × 108 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Interferon-omega (IFN-omega), a type I interferon, is a monomeric glycoprotein distantly related in structure to IFN-alpha and IFN-beta, but unrelated to IFN-gamma. The human type I interferon receptor complex, which mediates the biological activity of IFN-alpha and IFN-beta, also binds IFN-omega. IFN-omega is secreted by virus-infected leukocytes. Human IFN-ω binds to the α/β receptor but not to the interferon γ receptor[1]. IFN-omega has antiviral function on hepatitis B virus replication in human hepatoma cells[2]. IFN-ω also has been explored as a treatment option for some diseases or viral infections in humans and other animals[3].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-omega Protein, Human
Cat. No.:
HY-P7201
Quantity:
MCE Japan Authorized Agent: