IFN-omega 1 Protein, Human

IFN-omega 1 Protein, Human has antiviral, anti-proliferation, and antitumor activities that are similar to those of IFN-α.

Interferon-omega (IFN-omega), a type I interferon, is a monomeric glycoprotein distantly related in structure to IFN-alpha and IFN-beta, but unrelated to IFN-gamma. The human type I interferon receptor complex, which mediates the biological activity of IFN-alpha and IFN-beta, also binds IFN-omega. IFN-omega is secreted by virus-infected leukocytes. Human IFN-ω binds to the α/β receptor but not to the interferon γ receptor^[1]. IFN-omega has antiviral function on hepatitis B virus replication in human hepatoma cells^[2]. IFN-ω also has been explored as a treatment option for some diseases or viral infections in humans and other animals^[3].

The ED₅₀ is <0.01 ng/mL as measured by human TF-1 cells, corresponding to a specific activity of >1.0 × 10⁸ units/mg.

• 
  Measured in a cytotoxicity assay using TF-1 cells. The ED₅₀ for this effect is 0.008092 ng/mL, corresponding to a specific activity is 1.236×10⁸ Unit/mg.

Human

E. coli

Tag Free

P05000 (C24-S195)

3467  [NCBI]

Full Length of Mature Protein

CDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Flores, et al. Human interferon omega (omega) binds to the alpha/beta receptor. J Biol Chem. 1991 Oct 25;266(30):19875-7.  [Content Brief]

  [2]. Hagelstein J, et al. Antiviral potential of interferon-omega on hepatitis B virus replication in human hepatoma cells. Arzneimittelforschung. 1998 Mar;48(3):343-7.  [Content Brief]

  [3]. Li SF, et al. Interferon-omega: Current status in clinical applications. Int Immunopharmacol. 2017 Nov;52:253-260.  [Content Brief]