2. Recombinant Proteins
  3. Cytokines and Growth Factors
  4. Interferon & Receptors
  5. IFN-ω
  6. IFN-omega Protein, Human

IFN-omega Protein, Human

Cat. No.: HY-P7201
COA Handling Instructions

IFN-omega Protein, Human has antiviral, anti-proliferation, and antitumor activities that are similar to those of IFN-α.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock
10 μg $125 Ask For Quote & Lead Time
50 μg $350 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-omega Protein, Human has antiviral, anti-proliferation, and antitumor activities that are similar to those of IFN-α.
Background

Interferon-omega (IFN-omega), a type I interferon, is a monomeric glycoprotein distantly related in structure to IFN-alpha and IFN-beta, but unrelated to IFN-gamma. The human type I interferon receptor complex, which mediates the biological activity of IFN-alpha and IFN-beta, also binds IFN-omega. IFN-omega is secreted by virus-infected leukocytes. Human IFN-ω binds to the α/β receptor but not to the interferon γ receptor[1]. IFN-omega has antiviral function on hepatitis B virus replication in human hepatoma cells[2]. IFN-ω also has been explored as a treatment option for some diseases or viral infections in humans and other animals[3].
Species

Human
Source

E. coli
Tag

Tag Free
Accession

P05000 (C24-S195)
Gene ID
Molecular Construction
N-term
IFN-omega (C24-S195)
Accession # P05000
C-term
Synonyms
rHuIFN-ω; Interferon omega-1; IFNW1
AA Sequence

CDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS

Molecular Weight

Approximately 20.0 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation

COA (219 KB)

Handling Instructions (2659 KB)
References

IFN-omega Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-omega Protein, Human
Cat. No.:
HY-P7201
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.