IGFL1 Protein, Mouse (His-SUMO)
Based on 1 Customer Validation
IGFL1 Protein likely acts as a ligand for the IGFLR1 cell membrane receptor, forming a homodimer through disulfide bonds. IGFL1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived IGFL1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IGFL1 Protein likely acts as a ligand for the IGFLR1 cell membrane receptor, forming a homodimer through disulfide bonds. IGFL1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived IGFL1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
Background
IGFL1 protein is a probable ligand for the IGFLR1 cell membrane receptor. It exists as a homodimer, connected by disulfide bonds.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-SUMO;N-6*His
-
Accession
Q6B9Z0 (R25-P140)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
IGFL1 (R25-P140)
Accession # Q6B9Z0 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IGFL1; Insulin Growth Factor-Like Family Member 1; IGF Like Family Member 1; APRG644; UNQ644
-
AA Sequence
RKISTFSGPGSWPCNPKCDGRTYNPSEECCVHDTILPFKRINLCGPSCTYRPCFELCCPESYSPKKKFIVKLKVHGERSHCSSSPISRNCKSNKIFHGEDIEDNQLSLRKKSGDQP
-
Predicted Molecular Mass
26.1 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)