IgG Protein, Rabbit (T185A, N284S, HEK293)
Based on 3 publication(s) in Google Scholar
IgG protein, exhibits the D12 allotypic marker with the 104-Thr sequence and the E14 marker with 185-Thr. IgG Protein, Rabbit (T185A, N284S, HEK293) is the recombinant Rabbit-derived IgG protein, expressed by HEK293 , with tag free.
- Species: Rabbit
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IgG protein, exhibits the D12 allotypic marker with the 104-Thr sequence and the E14 marker with 185-Thr. IgG Protein, Rabbit (T185A, N284S, HEK293) is the recombinant Rabbit-derived IgG protein, expressed by HEK293 , with tag free.
Background
IgG protein, exhibits the D12 allotypic marker with the 104-Thr sequence and the E14 marker with 185-Thr.
Verified Bioactivity
Immobilized Rabbit IgG, Tag Free at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Human Fc gamma RI, His Tag with the EC50 of 10.5 ng/mL determined by ELISA.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Publications (3)
-
Journal Impact Factor
-
Most Recent
-
Adv Sci (Weinh)
SLC2A3-Mediated Lactate Metabolism Promotes Lung Cancer Bone Metastasis by Modulating P53 Lactylation and Immune Evasion. [Abstract]2026 Apr;13(22):e16622. PMID: 41637551 -
Int J Biol Sci
2025 Jan 1;21(2):758-771. PMID: 39781460 -
Technical Parameters
-
Species Rabbit
-
Source HEK293
-
Tag Tag Free
-
Accession
P01870 (S101-K323, T185A, N284S)
-
Gene ID100009097 [NCBI]
-
Molecular Construction
-
N-term
-
IgG (S101-K323, T185A, N284S)
Accession # P01870 -
C-term
-
-
Protein Length
Partial
-
Synonyms
Ig gamma chain C region
-
AA Sequence
SKPTCPPPELLGGPSVFIFPPKPKDTLMISRTPEVTCVVVDVSQDDPEVQFTWYINNEQVRTARPPLREQQFNSTIRVVSTLPIAHQDWLRGKEFKCKVHNKALPAPIEKTISKARGQPLEPKVYTMGPPREELSSRSVSLTCMINGFYPSDISVEWEKNGKAEDNYKTTPAVLDSDGSYFLYSKLSVPTSEWQRGDVFTCSVMHEALHNHYTQKSISRSPGK
-
Predicted Molecular Mass
25.1 kDa
-
Molecular Weight
Approximately 30-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as 0.22 μm filtered solution in PBS, 150mM NaCl, 10% Glycerol, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
