IgG2A Fc Protein, Rat (HEK293)

Ig gamma-2A chain C region (IgG2a) is one of the IgG antibodies subclasses and responses to an antigen. IgG2a plays a crucial role in the adaptive immune response^[1][2]. IgG2A Fc Protein, Rat (HEK293) is the recombinant rat-derived IgG2A Fc protein, expressed by HEK293 , with tag free. The total length of IgG2A Fc Protein, Rat (HEK293) is 225 a.a., with molecular weight of 30-35 kDa.

IgG2a is one of the IgG antibodies subclasses. IgG2a is produced by B cells and responses to an antigen. IgG2a monoclonal antibodies can inhibit murine tumor growth^[1]. IgG2a is invovled in pathogen defense by opsonization/complement fixation and immune effector functions^[2].

Rat

HEK293

Tag Free

P20760 (V98-K322)

679045

VPRECNPCGCTGSEVSSVFIFPPKTKDVLTITLTPKVTCVVVDISQNDPEVRFSWFIDDVEVHTAQTHAPEKQSNSTLRSVSELPIVHRDWLNGKTFKCKVNSGAFPAPIEKSISKPEGTPRGPQVYTMAPPKEEMTQSQVSITCMVKGFYPPDIYTEWKMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKETWQQGNTFTCSVLHEGLHNHHTEKSLSHSPGK

30-35 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, pH 8.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.