IgG4 Fc Protein, Human (HEK293)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The IgG4 Fc is the constant region of the immunoglobulin heavy chain, which forms the backbone of antibodies crucial in humoral immunity. B lymphocytes produce glycoprotein antibodies that initiate clonal expansion upon antigen binding. IgG4 Fc Protein, Human (HEK293) is the recombinant human-derived IgG4 Fc protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The IgG4 Fc is the constant region of the immunoglobulin heavy chain, which forms the backbone of antibodies crucial in humoral immunity. B lymphocytes produce glycoprotein antibodies that initiate clonal expansion upon antigen binding. IgG4 Fc Protein, Human (HEK293) is the recombinant human-derived IgG4 Fc protein, expressed by HEK293 , with tag free.

Background

The IgG4 Fc protein represents the constant region of immunoglobulin heavy chains, integral components of the humoral immune system. Immunoglobulins, or antibodies, are glycoproteins produced by B lymphocytes. In humoral immunity, membrane-bound immunoglobulins act as receptors, initiating the clonal expansion and differentiation of B lymphocytes into plasma cells upon antigen binding. The secreted immunoglobulins then execute the effector phase, leading to the elimination of bound antigens. Each immunoglobulin possesses two antigen-binding sites formed by the variable domains of one heavy chain and its associated light chain. These variable domains undergo V-(D)-J rearrangement and somatic hypermutations, enabling affinity maturation for specific antigens. Structurally, immunoglobulins consist of two identical heavy chains and two identical light chains linked by disulfide bonds. This intricate molecular architecture underscores their crucial role in immune recognition and response.

Verified Bioactivity

sIgG4 Fc immobilized on CM5 Chip can bind FCRN-B2M Heterodimer with an affinity constant of 944.2 nM as determined in SPR assay.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - SPR

    Bioactivity - SPR

    sIgG4 Fc immobilized on CM5 Chip can bind FCRN-B2M Heterodimer with an affinity constant of 944.2 nM as determined in SPR assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IgG4 Fc (E99-G326)
      Accession # P01861-1
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    IGHG4; Immunoglobulin Heavy Constant Gamma 4; Immunoglobulin Heavy Constant Gamma 4 (G4m Marker); Ig Gamma-4 Chain C Region; Immunoglobulin Heavy Chain Constant Region Gamma 4

  • AA Sequence

    ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG

  • Predicted Molecular Mass

    25.6 kDa

  • Molecular Weight

    Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00