IgG4 Fc Protein, Human (HEK293)
Based on 1 publication(s) in Google Scholar
The IgG4 Fc is the constant region of the immunoglobulin heavy chain, which forms the backbone of antibodies crucial in humoral immunity. B lymphocytes produce glycoprotein antibodies that initiate clonal expansion upon antigen binding. IgG4 Fc Protein, Human (HEK293) is the recombinant human-derived IgG4 Fc protein, expressed by HEK293 , with tag free.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The IgG4 Fc is the constant region of the immunoglobulin heavy chain, which forms the backbone of antibodies crucial in humoral immunity. B lymphocytes produce glycoprotein antibodies that initiate clonal expansion upon antigen binding. IgG4 Fc Protein, Human (HEK293) is the recombinant human-derived IgG4 Fc protein, expressed by HEK293 , with tag free.
Background
The IgG4 Fc protein represents the constant region of immunoglobulin heavy chains, integral components of the humoral immune system. Immunoglobulins, or antibodies, are glycoproteins produced by B lymphocytes. In humoral immunity, membrane-bound immunoglobulins act as receptors, initiating the clonal expansion and differentiation of B lymphocytes into plasma cells upon antigen binding. The secreted immunoglobulins then execute the effector phase, leading to the elimination of bound antigens. Each immunoglobulin possesses two antigen-binding sites formed by the variable domains of one heavy chain and its associated light chain. These variable domains undergo V-(D)-J rearrangement and somatic hypermutations, enabling affinity maturation for specific antigens. Structurally, immunoglobulins consist of two identical heavy chains and two identical light chains linked by disulfide bonds. This intricate molecular architecture underscores their crucial role in immune recognition and response.
Verified Bioactivity
sIgG4 Fc immobilized on CM5 Chip can bind FCRN-B2M Heterodimer with an affinity constant of 944.2 nM as determined in SPR assay.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - SPR
Bioactivity - SPR
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
J Clin Invest
Pediatric glioma immune profiling identifies TIM3 as a therapeutic target in BRAF fusion pilocytic astrocytoma. [Abstract]2024 Aug 13;134(19):e177413. PMID: 39137048
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P01861-1 (E99-G326)
-
Molecular Construction
-
N-term
-
IgG4 Fc (E99-G326)
Accession # P01861-1 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
IGHG4; Immunoglobulin Heavy Constant Gamma 4; Immunoglobulin Heavy Constant Gamma 4 (G4m Marker); Ig Gamma-4 Chain C Region; Immunoglobulin Heavy Chain Constant Region Gamma 4
-
AA Sequence
ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
-
Predicted Molecular Mass
25.6 kDa
-
Molecular Weight
Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)