IgG4 Fc Protein, Human (HEK293)

The IgG4 Fc is the constant region of the immunoglobulin heavy chain, which forms the backbone of antibodies crucial in humoral immunity. B lymphocytes produce glycoprotein antibodies that initiate clonal expansion upon antigen binding. IgG4 Fc Protein, Human (HEK293) is the recombinant human-derived IgG4 Fc protein, expressed by HEK293 , with tag free.

The IgG4 Fc protein represents the constant region of immunoglobulin heavy chains, integral components of the humoral immune system. Immunoglobulins, or antibodies, are glycoproteins produced by B lymphocytes. In humoral immunity, membrane-bound immunoglobulins act as receptors, initiating the clonal expansion and differentiation of B lymphocytes into plasma cells upon antigen binding. The secreted immunoglobulins then execute the effector phase, leading to the elimination of bound antigens. Each immunoglobulin possesses two antigen-binding sites formed by the variable domains of one heavy chain and its associated light chain. These variable domains undergo V-(D)-J rearrangement and somatic hypermutations, enabling affinity maturation for specific antigens. Structurally, immunoglobulins consist of two identical heavy chains and two identical light chains linked by disulfide bonds. This intricate molecular architecture underscores their crucial role in immune recognition and response.

sIgG4 Fc immobilized on CM5 Chip can bind FCRN-B2M Heterodimer with an affinity constant of 944.2 nM as determined in SPR assay.

• 
  sIgG4 Fc immobilized on CM5 Chip can bind FCRN-B2M Heterodimer with an affinity constant of 944.2 nM as determined in SPR assay.

Human

HEK293

Tag Free

P01861-1 (E99-G326)

3503  [NCBI]

Partial

ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG

Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.