IL-1 alpha/IL-1F1 Protein, Pig

Customer Review

Based on 1 Customer Validation

The IL-1α/IL-1F1 protein is found intracellularly in most non-hematopoietic cells and plays a crucial role in mediating inflammation and linking innate and adaptive immunity. IL1RAP binds to IL1R1 to form a high-affinity receptor complex that activates cascades and pathways.IL-1 alpha/IL-1F1 Protein, Pig is the recombinant Porcine-derived IL-1 alpha/IL-1F1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Porcine
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The IL-1α/IL-1F1 protein is found intracellularly in most non-hematopoietic cells and plays a crucial role in mediating inflammation and linking innate and adaptive immunity. IL1RAP binds to IL1R1 to form a high-affinity receptor complex that activates cascades and pathways.IL-1 alpha/IL-1F1 Protein, Pig is the recombinant Porcine-derived IL-1 alpha/IL-1F1 protein, expressed by E. coli , with tag free.

Background

The cytokine interleukin-1 alpha (IL-1 alpha), constitutively present intracellularly in almost all quiescent non-hematopoietic cells, plays a crucial role in inflammation and serves as a key mediator bridging the innate and adaptive immune systems. Upon binding to its receptor IL1R1, along with its accessory protein IL1RAP, IL-1 alpha forms the high-affinity interleukin-1 receptor complex, initiating signaling cascades involving the recruitment of adapter molecules such as MYD88, IRAK1, or IRAK4. This activation leads to the subsequent activation of NF-kappa-B and the three MAPK pathways—p38, p42/p44, and JNK pathways. Intracellularly, IL-1 alpha acts as an alarmin, and its release into the extracellular space upon cell death, following cell membrane disruption, induces inflammation and signals the host response to injury or damage. In addition to its role as a danger signal during cell necrosis, IL-1 alpha directly senses DNA damage, serving as a signal for genotoxic stress without compromising cell integrity. As a monomer, IL-1 alpha interacts with TMED10, facilitating translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and subsequent secretion. Furthermore, IL-1 alpha interacts with IL1R1 and S100A13, with the latter interaction being the initial step in the export of IL-1 alpha, followed by the direct translocation of this complex across the plasma membrane.

Verified Bioactivity

1.Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is 10-60 pg/mL.
2.Measured in a cell proliferation assay using CTTL2 cells. The ED50 for this effect is 6.554 pg/mL, corresponding to a specific activity is 1.526×108 units/mg.

Technical Parameters

  • Species Porcine
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    IL1A; IL-1A; Prev. IL1; Preinterleukin 1 Alpha; IL1F1; Interleukin-1 Alpha; Hematopoietin-1; IL-1 Alpha; IL1-ALPHA; Interleukin 1 Alpha; Pro-Interleukin-1-Alpha

  • AA Sequence

    QSNMKYNFMRVINHQCILNDARNQSIIRDPSGQYLMAAVLNNLDEAVKFDMAAYTSNDDSQLPVTLRISETRLFVSAQNEDEPVLLKELPETPKTIKDETSLLFFWEKHGNMDYFKSAAHPKLFIATRQEKLVHMAPGLPSVTDFQILENQS

  • Predicted Molecular Mass

    18.2 kDa

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS and DTT with BSA as a carrier protein.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00