IL-1 alpha Protein, Rhesus macaque

Customer Review

Based on 1 Customer Validation

IL-1 alpha, a cytokine present in non-hematopoietic cells, links innate and adaptive immunity. Binding to its receptor IL1R1, IL-1 alpha forms a receptor complex, activating signaling pathways involving MYD88, IRAK1, and IRAK4. It activates NF-kappa-B and MAPK pathways. Released during cell death, IL-1 alpha induces inflammation, senses DNA damage, and interacts with TMED10, IL1R1, and S100A13 for secretion and plasma membrane translocation. IL-1 alpha Protein, Rhesus macaque is the recombinant Rhesus Macaque-derived IL-1 alpha protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-1 alpha, a cytokine present in non-hematopoietic cells, links innate and adaptive immunity. Binding to its receptor IL1R1, IL-1 alpha forms a receptor complex, activating signaling pathways involving MYD88, IRAK1, and IRAK4. It activates NF-kappa-B and MAPK pathways. Released during cell death, IL-1 alpha induces inflammation, senses DNA damage, and interacts with TMED10, IL1R1, and S100A13 for secretion and plasma membrane translocation. IL-1 alpha Protein, Rhesus macaque is the recombinant Rhesus Macaque-derived IL-1 alpha protein, expressed by E. coli , with tag free.

Background

The IL-1 alpha protein, a cytokine intrinsically present in almost all quiescent non-hematopoietic cells, plays a pivotal role in inflammation, serving as a crucial link between the innate and adaptive immune systems. Upon binding to its receptor IL1R1, alongside its accessory protein IL1RAP, IL-1 alpha forms the high-affinity interleukin-1 receptor complex, initiating signaling pathways that involve the recruitment of adapter molecules such as MYD88, IRAK1, or IRAK4. This, in turn, activates NF-kappa-B and three MAPK pathways—p38, p42/p44, and JNK pathways. Internally, IL-1 alpha acts as an alarmin, being released into the extracellular space after cell membrane disruption during cell death, thereby inducing inflammation and signaling the host to injury or damage. Beyond its role as a danger signal released during cell necrosis, IL-1 alpha directly senses DNA damage and functions as a signal for genotoxic stress without compromising cell integrity. As a monomer, IL-1 alpha interacts with TMED10, facilitating its translocation from the cytoplasm to the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) for secretion. Additionally, it interacts with IL1R1 and S100A13, the latter being the initial step in IL-1 alpha export, followed by the direct translocation of this complex across the plasma membrane.

Verified Bioactivity

1.Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 10 pg/mL, corresponding to a specific activity of >1.0x108 IU/mg.
2.Measured in a cell proliferation assay using CTLL-2 cells. The ED50 for this effect is 19.28 pg/mL, corresponding to a specific activity is 5.187×107 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Rhesus Macaque
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-1α (S113-A271)
      Accession # P48089
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL1A; IL-1A; Prev. IL1; Preinterleukin 1 Alpha; IL1F1; Interleukin-1 Alpha; Hematopoietin-1; IL-1 Alpha; IL1-ALPHA; Interleukin 1 Alpha; Pro-Interleukin-1-Alpha

  • AA Sequence

    SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA

  • Predicted Molecular Mass

    18.1 kDa

  • Molecular Weight

    Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00