1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins
  3. Interleukin & Receptors B Cell CD Proteins NK Cell CD Proteins Cytokine Receptors
  4. IL-21R
  5. IL-21R Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

IL-21R Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

Cat. No.: HY-P76431
Handling Instructions Technical Support

Interleukin-21 receptor is a novel class I cytokine receptor that mediates its effects through the interaction with the common g chain (gc), making IL-21 the latest member of the family of gc cytokines, which includes IL-2, IL-4, IL-7, IL-9, IL-13, and IL-15. IL-21R Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived IL-21R protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Interleukin-21 receptor is a novel class I cytokine receptor that mediates its effects through the interaction with the common g chain (gc), making IL-21 the latest member of the family of gc cytokines, which includes IL-2, IL-4, IL-7, IL-9, IL-13, and IL-15. IL-21R Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived IL-21R protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Interleukin-21 receptor is a novel class I cytokine receptor that mediates its effects through the interaction with the common g chain (gc), making IL-21 the latest member of the family of gc cytokines, which includes IL-2, IL-4, IL-7, IL-9, IL-13, and IL-15. Interleukin-21 receptor enables cytokine receptor activity and protein binding. Interleukin-21 receptor is involved in cytokine-mediated signaling pathway and in immunoglobulin mediated immune response. Interleukin-21 receptor is located in external side of plasma membrane[1][2][3].

Species

Rhesus Macaque

Source

HEK293

Tag

C-hFc

Accession

G7Q0S8 (C41-P257)/XP_005591578 (C20-P236)

Gene ID
Molecular Construction
N-term
IL-21R (C20-P236)
Accession # XP_005591578
hFc
C-term
Protein Length

Partial

Synonyms
Interleukin-21 receptor; IL-21 receptor; IL-21R; CD360; Nilr
AA Sequence

CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNVTDHSGNYTQECGSFLLADSIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNP

Predicted Molecular Mass
52 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-21R Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-21R Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)
Cat. No.:
HY-P76431
Quantity:
MCE Japan Authorized Agent: