IL-33 Protein, Cynomolgus

IL-33 Protein is a cytokine belonging to the IL-1 superfamily. IL-33 induces helper T cells, mast cells, eosinophils and basophils to produce type 2 cytokines. IL-33 acts intracellularly as a nuclear factor and extracellularly as a cytokine. IL-33 mediates its biological effects via IL-1 receptor ST 2, activates NF-kappaB and MAP kinases, and drives production of T(H)2-associated cytokines from in vitro polarized T(H)2 cells. IL-33 Protein, Cynomolgus is the recombinant cynomolgus-derived IL-33 protein, expressed by E. coli , with tag free. The total length of IL-33 Protein, Cynomolgus is 159 a.a., with molecular weight of ~18.1 kDa.

Interleukin-33 (IL-33) is a cytokine belonging to the IL-1 superfamily and it main sources include human endothelial cells and mouse adventitial stromal cells of the vascular tree; epithelial cells in barrier tissues; fibroblast reticular cells (FRCs) in the lymphoid organs; and glial cells, neurons, and astrocytes in the nervous system. IL-33 induces helper T cells, mast cells, eosinophils and basophils to produce type 2 cytokines. IL-33 acts intracellularly as a nuclear factor and extracellularly as a cytokine. As a cytokine, IL-33 mediates its biological effects via IL-1 receptor ST 2, activates NF-kappaB and MAP kinases, and drives production of T(H)2-associated cytokines from in vitro polarized T(H)2 cells. In vivo, IL-33 induces the expression of IL-4, IL-5, and IL-13 and leads to severe pathological changes in mucosal organs. Cellular stress or exposure to inflammation can augment or induce cellular expression of IL-33. IL-33 exhibits pleiotropic functions supporting IFN-γ-, IL-9-, and IL-17-dominated immune responses as part of the host response to pathogens or immune-mediated inflammatory diseases^[1][2].

Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus IL-33 Protein is immobilized at 5 µg/mL (100 µL/well) can bind Recombinant Human IL1RL1 Protein. The ED₅₀ for this effect is 55.8 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus IL-33 Protein is immobilized at 5 µg/mL (100 µL/well) can bind Recombinant Human IL1RL1 Protein. The ED₅₀ for this effect is 55.8 ng/mL.

Cynomolgus

E. coli

Tag Free

XP_005581824 (S112-I270)

102140695  [NCBI]

SITGISPITESLASLSTYNDQSITFALEDESYEIYVEDLKKDKKKDKVLLSYYESQHPSSESGDGVDGKMLMVTLSPTKDFWLQANNKEHSVELHKCEKPLPDQAFFVLHNRSFNCVSFECKTDPGVFIGVKDNHLALIKVDYSENLGSENILFKLSEI

Approximately 18.1 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.