IL-33 Protein, Cynomolgus
Based on 1 Customer Validation
IL-33 Protein is a cytokine belonging to the IL-1 superfamily. IL-33 induces helper T cells, mast cells, eosinophils and basophils to produce type 2 cytokines. IL-33 acts intracellularly as a nuclear factor and extracellularly as a cytokine. IL-33 mediates its biological effects via IL-1 receptor ST 2, activates NF-kappaB and MAP kinases, and drives production of T(H)2-associated cytokines from in vitro polarized T(H)2 cells. IL-33 Protein, Cynomolgus is the recombinant cynomolgus-derived IL-33 protein, expressed by E. coli , with tag free.
- Species: Cynomolgus
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-33 Protein is a cytokine belonging to the IL-1 superfamily. IL-33 induces helper T cells, mast cells, eosinophils and basophils to produce type 2 cytokines. IL-33 acts intracellularly as a nuclear factor and extracellularly as a cytokine. IL-33 mediates its biological effects via IL-1 receptor ST 2, activates NF-kappaB and MAP kinases, and drives production of T(H)2-associated cytokines from in vitro polarized T(H)2 cells. IL-33 Protein, Cynomolgus is the recombinant cynomolgus-derived IL-33 protein, expressed by E. coli , with tag free.
Background
Interleukin-33 (IL-33) is a cytokine belonging to the IL-1 superfamily and it main sources include human endothelial cells and mouse adventitial stromal cells of the vascular tree; epithelial cells in barrier tissues; fibroblast reticular cells (FRCs) in the lymphoid organs; and glial cells, neurons, and astrocytes in the nervous system. IL-33 induces helper T cells, mast cells, eosinophils and basophils to produce type 2 cytokines. IL-33 acts intracellularly as a nuclear factor and extracellularly as a cytokine. As a cytokine, IL-33 mediates its biological effects via IL-1 receptor ST 2, activates NF-kappaB and MAP kinases, and drives production of T(H)2-associated cytokines from in vitro polarized T(H)2 cells. In vivo, IL-33 induces the expression of IL-4, IL-5, and IL-13 and leads to severe pathological changes in mucosal organs. Cellular stress or exposure to inflammation can augment or induce cellular expression of IL-33. IL-33 exhibits pleiotropic functions supporting IFN-γ-, IL-9-, and IL-17-dominated immune responses as part of the host response to pathogens or immune-mediated inflammatory diseases[1][2].
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus IL-33 Protein is immobilized at 5 µg/mL (100 µL/well) can bind Recombinant Human IL1RL1 Protein. The ED50 for this effect is 55.8 ng/mL.
Technical Parameters
-
Species Cynomolgus
-
Source E. coli
-
Tag Tag Free
-
Accession
A0A2K5W3I1/XP_005581824 (S112-I270)
-
Molecular Construction
-
N-term
-
IL-33 (S112-I270)
Accession # A0A2K5W3I1/XP_005581824 -
C-term
-
-
Protein Length
Full Length of Interleukin 33 C-terminal Domain
-
Synonyms
IL33; DVS27-Related Protein; Prev. C9orf26; Chromosome 9 Open Reading Frame 26 (NF-HEV); NF-HEV; Interleukin-1 Family, Member 11; IL1F11; Alternative Protein IL33; Interleukin-33; IL-1F11; DVS27; NFEHEV; Nuclear Factor From High Endothelial Venules; IL-33
-
AA Sequence
SITGISPITESLASLSTYNDQSITFALEDESYEIYVEDLKKDKKKDKVLLSYYESQHPSSESGDGVDGKMLMVTLSPTKDFWLQANNKEHSVELHKCEKPLPDQAFFVLHNRSFNCVSFECKTDPGVFIGVKDNHLALIKVDYSENLGSENILFKLSEI
-
Predicted Molecular Mass
17.9 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
