1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-33
  5. IL-33 Protein, Human (C208S, C227S, C232S, C259S, HEK293, His )

IL-33 Protein, Human (C208S, C227S, C232S, C259S, HEK293, His )

Cat. No.: HY-P704714
Handling Instructions Technical Support

IL-33 protein, as a cytokine, binds to and signals through the IL1RL1/ST2 receptor, thereby activating the NF-kappa-B and MAPK signaling pathways in target cells. It is involved in the maturation of Th2 cells and contributes to the secretion of T helper cell type 2 related cytokines. IL-33 Protein, Human (C208S, C227S, C232S, C259S, HEK293, His ) is the recombinant human-derived IL-33 protein, expressed by HEK293, with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
50 μg 견적 받기 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   견적 받기  
Synthetic products have potential research and development risk.

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

IL-33 protein, as a cytokine, binds to and signals through the IL1RL1/ST2 receptor, thereby activating the NF-kappa-B and MAPK signaling pathways in target cells. It is involved in the maturation of Th2 cells and contributes to the secretion of T helper cell type 2 related cytokines. IL-33 Protein, Human (C208S, C227S, C232S, C259S, HEK293, His ) is the recombinant human-derived IL-33 protein, expressed by HEK293, with C-His labeled tag.

Background

IL-33 protein, functioning as a cytokine, binds to and signals through the IL1RL1/ST2 receptor, thereby activating the NF-kappa-B and MAPK signaling pathways in target cells. Its involvement in the maturation of Th2 cells contributes to the secretion of T-helper type 2-associated cytokines. Additionally, IL-33 plays a crucial role in the activation of mast cells, basophils, eosinophils, and natural killer cells. Acting as an enhancer of the polarization of alternatively activated macrophages, it serves as a chemoattractant for Th2 cells and may function as an 'alarmin,' amplifying immune responses during tissue injury. IL-33 induces rapid UCP2-dependent mitochondrial rewiring, mitigating the generation of reactive oxygen species and preserving the integrity of the Krebs cycle, which is essential for the persistent production of itaconate and subsequent GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages. In quiescent endothelia, the uncleaved form of IL-33 is constitutively and abundantly expressed, acting as a chromatin-associated nuclear factor with transcriptional repressor properties, potentially sequestering nuclear NF-kappaB/RELA and thereby lowering the expression of its targets; this form is rapidly lost upon angiogenic or pro-inflammatory activation.

Species

Human

Source

HEK293

Tag

C-His

Accession

O95760-1 (H109-T270, C208S, C227S, C232S, C259S)

Gene ID

90865

Molecular Construction
N-term
IL-33 (H109-T270,C208S, C227S, C232S, C259S)
Accession # O95760-1
His
C-term
Protein Length

Full Length of Interleukin-33 (109-270)

Synonyms
rHuIL-33; IL-1F11; NF-HEV; DVS 27
AA Sequence

HDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKSEKPLPDQAFFVLHNMHSNSVSFESKTDPGVFIGVKDNHLALIKVDSSENLSTENILFKLSET

Predicted Molecular Mass
20.2 kDa.
분자량

Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

IL-33 Protein, Human (C208S, C227S, C232S, C259S, HEK293, His ) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

IL-33 Protein, Human (C208S, C227S, C232S, C259S, HEK293, His )

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
IL-33 Protein, Human (C208S, C227S, C232S, C259S, HEK293, His )
Cat. No.:
HY-P704714
수량:
MCE Japan Authorized Agent: