IL-33 Protein, Human (HEK293, His)

IL-33 protein, as a cytokine, binds to and signals through the IL1RL1/ST2 receptor, thereby activating the NF-kappa-B and MAPK signaling pathways in target cells. It is involved in the maturation of Th2 cells and contributes to the secretion of T helper cell type 2 related cytokines. IL-33 Protein, Human (HEK293, His) is the recombinant human-derived IL-33 protein, expressed by HEK293, with N-His labeled tag.

IL-33 protein, functioning as a cytokine, binds to and signals through the IL1RL1/ST2 receptor, thereby activating the NF-kappa-B and MAPK signaling pathways in target cells. Its involvement in the maturation of Th2 cells contributes to the secretion of T-helper type 2-associated cytokines. Additionally, IL-33 plays a crucial role in the activation of mast cells, basophils, eosinophils, and natural killer cells. Acting as an enhancer of the polarization of alternatively activated macrophages, it serves as a chemoattractant for Th2 cells and may function as an 'alarmin,' amplifying immune responses during tissue injury. IL-33 induces rapid UCP2-dependent mitochondrial rewiring, mitigating the generation of reactive oxygen species and preserving the integrity of the Krebs cycle, which is essential for the persistent production of itaconate and subsequent GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages. In quiescent endothelia, the uncleaved form of IL-33 is constitutively and abundantly expressed, acting as a chromatin-associated nuclear factor with transcriptional repressor properties, potentially sequestering nuclear NF-kappaB/RELA and thereby lowering the expression of its targets; this form is rapidly lost upon angiogenic or pro-inflammatory activation.

Human

HEK293

N-His

O95760-1 (S112-T270)

90865

Partial

SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

Approximately 25-30 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.