1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors Neurotrophic Factors
  4. IL-6
  5. IL-6 Protein, Human (CHO)

IL-6 Protein, Human (CHO)

Cat. No.: HY-P7044A
SDS COA Handling Instructions

IL-6 Protein, Human (CHO) is a potent inducer of the synthesis of acute phase proteins in adult human hepatocytes.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE IL-6 Protein, Human (CHO)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-6 Protein, Human (CHO) is a potent inducer of the synthesis of acute phase proteins in adult human hepatocytes.

Background

Interleukin-6 (IL-6) is a 26-kD protein released by fibroblasts, T lymphocytes, endothelial cells, monocytes, and keratinocytes during inflammatory responses. IL-6 has pluripotent activities, including the stimulation of the monocytic lineage, the induction of megakaryopoiesis and the hepatic acute phase response, as well as the modulation of T- and B-cell responses. IL-6 is also capable of mediating direct and indirect tumor cell destruction and that it is potentially important for the immunotherapy of cancer [1]. Recombinant human interleukin-6 (IL-6/BSF-2/HSF) regulates the synthesis of acute phase proteins in human hepatocytes[2].

Biological Activity

The ED50 is <1 ng/mL as measured in a cell proliferation assay using TF-1 cells.

Species

Human

Source

CHO

Tag

Tag Free

Accession

P05231 (P29-M212)

Gene ID
Molecular Construction
N-term
IL-6 (P29-M212)
Accession # P05231
C-term
Synonyms
rHuIL-6; BSF-2; CDF; Hybridoma growth factor; IFN-beta-2
AA Sequence

PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Molecular Weight

21-23 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 10 mM acetic acid or PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-6 Protein, Human (CHO)
Cat. No.:
HY-P7044A
Quantity:
MCE Japan Authorized Agent: