IL-7 Protein, Human
Based on 4 publication(s) in Google Scholar
IL-7 Protein, Human, a hematopoietic cytokine, promotes T-cell recovery after allogeneic stem cell transplantation.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-7 Protein, Human, a hematopoietic cytokine, promotes T-cell recovery after allogeneic stem cell transplantation.
Background
Recombinant Human Interleukin-7 (r-hIL-7) has a central role in T-cell development and survival and enhances immune recovery in murine models of allo-hematopoietic stem cell transplantation (allo-HSCT). Recombinant Human Interleukin-7 induces a doubling in CD4+ and CD8+ T cells. The main effect of IL-7 is an expansion of effector memory T cells. r-hIL-7 can enhance immune recovery after a T cell–depleted allo-HSCT without causing significant GVHD or other serious toxicity[1].
Verified Bioactivity
1.The ED50 is <0.5 ng/mL as measured by murine 2E8 cells, corresponding to a specific activity of >2.0 × 106 units/mg.
2.Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL). The ED50 for this effect is 0.02-0.08 ng/mL.
3.Measured in a cell proliferation assay using Jurkat cells. The ED50 for this effect is <0.5 ng/mL.
4.Recombinant Human CD127 / IL-7RA immobilized on CM5 Chip can bind Human IL-7 with an affinity constant of 10-25 nM as determined in a SPR assay.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (4)
-
Journal Impact Factor
-
Most Recent
-
Cancer Biol Med
Neoepitope BTLAP267L-specific TCR-T cell immunotherapy unlocks precision treatment for hepatocellular carcinoma. [Abstract]2025 Apr 9:j.issn.2095-3941.2024.0434. PMID: 40205806 -
Cancer Immunol Immunother
The transcription factor FOXA1 upregulates PYCR1-mediated autophagy to suppress antitumor immunity in lung adenocarcinoma. [Abstract]2025 Aug 23;74(9):290. PMID: 40848149 -
Immunology
Deubiquitinating Enzyme UCHL1 Modulates FHL2 to Block Ferroptosis and Counteract CD8+ T Cell Anti-Tumour Immunity in Lung Adenocarcinoma. [Abstract]2025 Oct 22. PMID: 41123299 -
Prostate
MEIS2 Modulates Oxidative Phosphorylation and ROS Generation to Affect CD8+ T Cell Antitumor Immunity in Prostate Cancer. [Abstract]2025 Oct 1. PMID: 41031828
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P13232-1 (D26-H177)
-
Molecular Construction
-
N-term
-
IL-7 (D26-H177)
Accession # P13232 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
IL7; IL7 Nirs Variant 5; Interleukin 7; IL7 Nirs Variant 3; IL-7; IMD130; Interleukin-7
-
AA Sequence
DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
-
Predicted Molecular Mass
17.5 kDa
-
Molecular Weight
Approximately 18-18 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 300 mM NaCl, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)