1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-7
  5. IL-7 Protein, Human

IL-7 Protein, Human

Cat. No.: HY-P7045
COA Handling Instructions

IL-7 Protein, Human, a hematopoietic cytokine, promotes T-cell recovery after allogeneic stem cell transplantation.

For research use only. We do not sell to patients.

Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $620 In-stock
Estimated Time of Arrival: December 31
100 μg $1050 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-7 Protein, Human, a hematopoietic cytokine, promotes T-cell recovery after allogeneic stem cell transplantation.

Background

Recombinant Human Interleukin-7 (r-hIL-7) has a central role in T-cell development and survival and enhances immune recovery in murine models of allo-hematopoietic stem cell transplantation (allo-HSCT). Recombinant Human Interleukin-7 induces a doubling in CD4+ and CD8+ T cells. The main effect of IL-7 is an expansion of effector memory T cells. r-hIL-7 can enhance immune recovery after a T cell–depleted allo-HSCT without causing significant GVHD or other serious toxicity[1].

Biological Activity
1.The ED50 is <0.5 ng/mL as measured by murine 2E8 cells, corresponding to a specific activity of >2.0 × 106 units/mg.
2.Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL). The ED50 for this effect is 0.02-0.08 ng/mL.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P13232 (D26-H177)

Gene ID
Synonyms
rHuIL-7; LP-1; pre-B cell factor
AA Sequence

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Molecular Weight

Approximately 20.0 kD

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 300 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-7 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-7 Protein, Human
Cat. No.:
HY-P7045
Quantity:
MCE Japan Authorized Agent: