1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-9
  5. IL-9 Protein, Rat (sf9, His)

IL-9 Protein, with cytokine and receptor binding activities, positively regulates cell growth. Active in the extracellular space, its human orthologs are linked to asthma and respiratory syncytial virus disease. IL-9 expression is biased, notably in testes (RPKM 6.4) and thymus (RPKM 1.0), suggesting involvement in immune and respiratory processes. IL-9 Protein, Rat (sf9, His) is the recombinant rat-derived IL-9 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-9 Protein, with cytokine and receptor binding activities, positively regulates cell growth. Active in the extracellular space, its human orthologs are linked to asthma and respiratory syncytial virus disease. IL-9 expression is biased, notably in testes (RPKM 6.4) and thymus (RPKM 1.0), suggesting involvement in immune and respiratory processes. IL-9 Protein, Rat (sf9, His) is the recombinant rat-derived IL-9 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

IL-9 Protein exhibits cytokine activity and interleukin-9 receptor binding activity, playing a role in the positive regulation of cell growth. It is predicted to be active in the extracellular space. Human ortholog(s) of this gene have been implicated in asthma and respiratory syncytial virus infectious disease. The expression of IL-9 is biased, with notable levels observed in testes (RPKM 6.4) and thymus (RPKM 1.0), indicating its potential involvement in immune and respiratory processes.

Biological Activity

Measured in a cell proliferation assay using MC/9-2 mouse mast cells. The ED50 for this effect is typically 50-400ng/mL.

Species

Rat

Source

Sf9 insect cells

Tag

C-His

Accession

A6KAN0/NP_001099217.1 (Q19-A144)

Gene ID
Molecular Construction
N-term
IL-9 (Q19-A144)
Accession # NP_001099217.1
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-9; IL-9; Cytokine P40; IL9
AA Sequence

QRCSTSWGIQHTSYLIENLKDDPSSKCSCSANVTSCLCLPIPSDDCTTPCFQEGMSQVTNATQQSKFSPFFFRVKRIVETLKSNKCQFFSCEKPCNQTTAGNTVSFLKSLLKTFQKTEVQVQRSRA

Predicted Molecular Mass
15.6 kDa
Molecular Weight

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM PB, 300 mM NaCl, 10% Glycerol, pH 7.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

IL-9 Protein, Rat (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-9 Protein, Rat (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-9 Protein, Rat (sf9, His)
Cat. No.:
HY-P73230
Quantity:
MCE Japan Authorized Agent: