Integrin alpha 2B beta 3 Protein, Human (HEK293, His)

Integrin alpha 2B beta 3 Protein, found on platelets, plays a crucial role in blood clotting. It binds to fibrinogen, facilitating platelet aggregation and forming stable clots. Understanding the functions of Integrin alpha 2B beta 3 Protein can help in developing therapies for clotting disorders and improving hemostasis. Integrin alpha 2B beta 3 Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived Integrin alpha 2B beta 3 protein, expressed by HEK293 , with C-His labeled tag. Integrin alpha 2B beta 3 Protein, Human (HEK293, His), has molecular weight of 95-115 kDa.

Integrin alpha-IIb/beta-3 serves as a versatile receptor, recognizing a diverse range of ligands such as fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin, and vitronectin. Its recognition motif includes the sequence R-G-D and the specific sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Upon activation, integrin alpha-IIb/beta-3 mediates platelet-platelet interaction through the binding of soluble fibrinogen, initiating rapid platelet aggregation that forms a physical plug on the ruptured endothelial cell surface. This heterodimeric integrin comprises an alpha subunit, consisting of heavy and light chains linked by a disulfide bond, and a beta subunit (beta-3) that associates with the alpha-IIb subunit. Integrin alpha-IIb/beta-3 engages in direct interactions with various proteins, including RNF181, CIB1, CIB2, CIB3, and CIB4, with some interactions being calcium and magnesium-dependent. Additionally, it interacts with PPIA/CYPA in a manner influenced by reactive oxygen species (ROS), PPIase activity, and thrombin presence.

1.Loaded Abciximab (HY-P9934) on AHC2 biosensor, can bind Integrin alpha 2B beta 3 Protein, Human (HEK293, His) with an affinity constant of 2.475E-09 M as determined in BLI assay.
2.Immobilized Anti-GPIIb/IIIa at 2 μg/mL (100 μL/well) can bind Human Integrin alpha 2B beta 3 Protein. The ED₅₀ for this effect is 21.64 ng/mL.

• 
  Immobilized Anti-GPIIb/IIIa at 2 μg/mL (100 μL/well) can bind Human Integrin alpha 2B beta 3 Protein. The ED₅₀ for this effect is 21.64 ng/mL.
• 
  Loaded Abciximab (HY-P9934) on AHC2 biosensor, can bind Integrin alpha 2B beta 3 Protein, Human (HEK293, His) with an affinity constant of 2.475E-09 M as determined in BLI assay.

Human

HEK293

C-8*His

P08514 (L32-R993)&P05106 (G27-D718)

3674  [NCBI]&3690  [NCBI]

ITGA2B:
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQ
VWTQLLRALE ITGB3:
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPD

Approximately 95-120 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.