Copy Link Print Information

Integrin alpha 2B beta 3 Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Integrin alpha 2B beta 3 Protein, found on platelets, plays a crucial role in blood clotting. It binds to fibrinogen, facilitating platelet aggregation and forming stable clots. Understanding the functions of Integrin alpha 2B beta 3 Protein can help in developing therapies for clotting disorders and improving hemostasis. Integrin alpha 2B beta 3 Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived Integrin alpha 2B beta 3 protein, expressed by HEK293 , with C-His labeled tag. Integrin alpha 2B beta 3 Protein, Human (HEK293, His), has molecular weight of 95-115 kDa.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Integrin alpha 2B beta 3 Protein, Human (HEK293, His)
  • Experimental Validation Results for Integrin alpha 2B beta 3 Protein, Human (HEK293, His)
  • Experimental Validation Results for Integrin alpha 2B beta 3 Protein, Human (HEK293, His)
  • Integrin alpha 2B beta 3 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Integrin alpha 2B beta 3 Protein, found on platelets, plays a crucial role in blood clotting. It binds to fibrinogen, facilitating platelet aggregation and forming stable clots. Understanding the functions of Integrin alpha 2B beta 3 Protein can help in developing therapies for clotting disorders and improving hemostasis. Integrin alpha 2B beta 3 Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived Integrin alpha 2B beta 3 protein, expressed by HEK293 , with C-His labeled tag. Integrin alpha 2B beta 3 Protein, Human (HEK293, His), has molecular weight of 95-115 kDa.

Background

Integrin alpha-IIb/beta-3 serves as a versatile receptor, recognizing a diverse range of ligands such as fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin, and vitronectin. Its recognition motif includes the sequence R-G-D and the specific sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Upon activation, integrin alpha-IIb/beta-3 mediates platelet-platelet interaction through the binding of soluble fibrinogen, initiating rapid platelet aggregation that forms a physical plug on the ruptured endothelial cell surface. This heterodimeric integrin comprises an alpha subunit, consisting of heavy and light chains linked by a disulfide bond, and a beta subunit (beta-3) that associates with the alpha-IIb subunit. Integrin alpha-IIb/beta-3 engages in direct interactions with various proteins, including RNF181, CIB1, CIB2, CIB3, and CIB4, with some interactions being calcium and magnesium-dependent. Additionally, it interacts with PPIA/CYPA in a manner influenced by reactive oxygen species (ROS), PPIase activity, and thrombin presence.

Verified Bioactivity

1.Loaded Abciximab (HY-P9934) on AHC2 biosensor, can bind Integrin alpha 2B beta 3 Protein, Human (HEK293, His) with an affinity constant of 2.475E-09 M as determined in BLI assay.
2.Immobilized Anti-GPIIb/IIIa at 2 μg/mL (100 μL/well) can bind Human Integrin alpha 2B beta 3 Protein. The ED50 for this effect is 21.64 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-8*His
  • Accession

    P08514 (L32-R993)&P05106 (G27-D718)

  • Gene ID
    3674  [NCBI]&3690  [NCBI]
  • Synonyms

    ITGA2B; Platelet Fibrinogen Receptor, Alpha Subunit; Prev. GP2B; Platelet Glycoprotein IIb; GPIIb; AlphaIIb Protein; Integrin Alpha-IIb; Glycoprotein IIb; PPP1R93; CD41 Antigen; CD41B; BDPLT16; CD41; BDPLT2; Integrin, Alpha 2b (Platelet Glycoprotein IIb O

  • AA Sequence

    ITGA2B:
    LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQ
    VWTQLLRALE ITGB3:
    GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPD

  • Molecular Weight

    Approximately 95-120 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE or Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Immobilized Anti-GPIIb/IIIa at 2 μg/mL (100 μL/well) can bind Human Integrin alpha 2B beta 3 Protein. The ED50 for this effect is 21.64 ng/mL.

  • 1/16

    MedChemExpress Validation
     Loaded Abciximab (HY-P9934) on AHC2 biosensor, can bind Integrin alpha 2B beta 3 Protein, Human (HEK293, His) with an affinity constant of 2.475E-09 M as determined in BLI assay.

  • Integrin alpha 2B beta 3 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Integrin alpha 2B beta 3 Protein, Human (HEK293, His)
  • Experimental Validation Results for Integrin alpha 2B beta 3 Protein, Human (HEK293, His)
  • Experimental Validation Results for Integrin alpha 2B beta 3 Protein, Human (HEK293, His)
  • Integrin alpha 2B beta 3 Protein, Human (HEK293, His) Product Image