Interferon tau-1/IFNT1 Protein, Bovine (P.pastoris, His)

Interferon tau-1 (IFNT1) serves as an important paracrine hormone that initiates maternal recognition of pregnancy. After interacting with endometrial receptors, possibly type I interferon receptors, IFNT1 blocks estrogen receptor expression and prevents estrogen-induced upregulation of oxytocin receptor expression. Interferon tau-1/IFNT1 Protein, Bovine (P.pastoris, His) is the recombinant bovine-derived Interferon tau-1/IFNT1 protein, expressed by P. pastoris , with N-His labeled tag. The total length of Interferon tau-1/IFNT1 Protein, Bovine (P.pastoris, His) is 172 a.a., with molecular weight of ~21.8 kDa.

Interferon tau-1 (IFNT1) serves as a paracrine hormone pivotal for initiating maternal recognition of pregnancy. Upon interaction with endometrial receptors, likely type I interferon receptors, IFNT1 plays a crucial role in blocking estrogen receptor expression, effectively impeding the estrogen-induced upregulation of oxytocin receptor expression in the endometrium. This mechanism results in the suppression of pulsatile endometrial release of the luteolytic hormone prostaglandin F2-alpha, thereby preventing the regression of the corpus luteum (luteolysis) and facilitating the maintenance of ovarian cyclicity. Additionally, IFNT1, possibly through a direct impact on prostaglandin synthesis, sustains ovarian progesterone secretion, stimulating the endometrial secretion of nutrients necessary for conceptus growth. Notably, IFNT1 exhibits exceptional antiviral and antiproliferative potency, coupled with low cytotoxicity, high antiluteolytic activity, and immunomodulatory properties. A distinctive feature is its lack of virally inducibility in contrast to other interferons.

Bovine

P. pastoris

N-His

P15696 (24C-195L)

317698  [NCBI]

CYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLPQEMVEGNQLQKDQAISVLHEMLQQCFNLFYTEHSSAAWNTTLLEQLCTGLQQQLEDLDACLGPVMGEKDSDMGRMGPILTVKKYFQGIHVYLKEKEYSDCAWEIIRVEMMRALSSSTTLQKRLRKMGGDLNSL

Approximately 21.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in Tris-based buffer, 50% glycerol.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.