Intrinsic Factor/GIF Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Intrinsic factor (GIF) plays a crucial role in cobalamin (Cbl) absorption in the ileum. This well-coordinated process involves the interaction of the CBLIF-cobalamin complex with the Cubilin (CUBN) receptor, leading to internalization via receptor-mediated endocytosis. Intrinsic Factor/GIF Protein, Human (HEK293, His) is the recombinant human-derived Intrinsic Factor/GIF protein, expressed by HEK293 , with C-His, C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Intrinsic factor (GIF) plays a crucial role in cobalamin (Cbl) absorption in the ileum. This well-coordinated process involves the interaction of the CBLIF-cobalamin complex with the Cubilin (CUBN) receptor, leading to internalization via receptor-mediated endocytosis. Intrinsic Factor/GIF Protein, Human (HEK293, His) is the recombinant human-derived Intrinsic Factor/GIF protein, expressed by HEK293 , with C-His, C-6*His labeled tag.

Background

Intrinsic Factor (GIF) stands as a key facilitator in the absorption of the essential vitamin cobalamin (Cbl) in the ileum. Its pivotal role unfolds through a well-orchestrated process, where the CBLIF-cobalamin complex, upon interaction with the Cubilin (CUBN) receptor, undergoes internalization via receptor-mediated endocytosis. This intricate interplay underscores the significance of GIF in ensuring the effective absorption of cobalamin, a crucial vitamin for various physiological processes. GIF's interaction with CUBN, particularly involving CUB domains, highlights the molecular intricacies governing this essential aspect of vitamin uptake.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GIF (S19-Y417)
      Accession # P27352-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    CBLIF; IF; Prev. GIF; Gastric Intrinsic Factor (Vitamin B Synthesis); IFMH; Gastric Intrinsic Factor; INF; Intrinsic Factor; Cobalamin Binding Intrinsic Factor; TCN3

  • AA Sequence

    STQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY

  • Molecular Weight

    Approximately 49 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00