Intrinsic Factor/GIF Protein, Human (HEK293, His)

Intrinsic factor (GIF) plays a crucial role in cobalamin (Cbl) absorption in the ileum. This well-coordinated process involves the interaction of the CBLIF-cobalamin complex with the Cubilin (CUBN) receptor, leading to internalization via receptor-mediated endocytosis. Intrinsic Factor/GIF Protein, Human (HEK293, His) is the recombinant human-derived Intrinsic Factor/GIF protein, expressed by HEK293 , with C-His, C-6*His labeled tag. The total length of Intrinsic Factor/GIF Protein, Human (HEK293, His) is 399 a.a., with molecular weight of ~49 kDa.

Intrinsic Factor (GIF) stands as a key facilitator in the absorption of the essential vitamin cobalamin (Cbl) in the ileum. Its pivotal role unfolds through a well-orchestrated process, where the CBLIF-cobalamin complex, upon interaction with the Cubilin (CUBN) receptor, undergoes internalization via receptor-mediated endocytosis. This intricate interplay underscores the significance of GIF in ensuring the effective absorption of cobalamin, a crucial vitamin for various physiological processes. GIF's interaction with CUBN, particularly involving CUB domains, highlights the molecular intricacies governing this essential aspect of vitamin uptake.

Data is not available.

Human

HEK293

C-6*His

P27352-1 (S19-Y417)

2694  [NCBI]

STQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY

Approximately 49 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.