ISCU Protein, Human (sf9, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

ISCU is an important mitochondrial scaffolding protein in the ISC assembly complex and forms the structural basis of [2Fe-2S] cluster assembly. ISCU relies on FXN to centrally receive persulfide during de novo synthesis initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1). ISCU Protein, Human (sf9, His) is the recombinant human-derived ISCU protein, expressed by sf9 insect cells , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ISCU is an important mitochondrial scaffolding protein in the ISC assembly complex and forms the structural basis of [2Fe-2S] cluster assembly. ISCU relies on FXN to centrally receive persulfide during de novo synthesis initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1). ISCU Protein, Human (sf9, His) is the recombinant human-derived ISCU protein, expressed by sf9 insect cells , with N-6*His labeled tag.

Background

ISCU, a pivotal mitochondrial scaffold protein within the core iron-sulfur cluster (ISC) assembly complex, serves as the structural foundation for the assembly of [2Fe-2S] clusters. In the intricate process of de novo synthesis of [2Fe-2S] clusters, initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1), ISCU plays a central role by receiving persulfide in a FXN-dependent manner. Stabilization of this complex is facilitated by FDX2, providing reducing equivalents for efficient [2Fe-2S] cluster assembly. Subsequently, ISCU acts as a crucial intermediary, transferring the assembled [2Fe-2S] cluster to chaperone proteins, including HSCB, HSPA9, and GLRX5. Notably, ISCU exhibits dynamic conformational states, alternating between structured (S) and disordered (D) forms. Its zinc-dependent modulation of NFS1 desulfurase activity and influence on the interaction between FXN and the cysteine desulfurase complex further underscore its multifaceted role. Additionally, as a cytoplasmic scaffold protein, ISCU contributes to the structural framework of the cytoplasmic ISC assembly complex, participating in the assembly of Fe-S clusters and potentially contributing to cytoplasmic iron-sulfur protein biogenesis.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • ISCU (Y35-K167)
      Accession # Q9H1K1-1
    • Myc
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    ISCU; Iron-Sulfur Cluster Assembly Enzyme ISCU, Mitochondrial; Prev. NIFUN; Iron-Sulfur Cluster Scaffold Homolog (E. Coli); NifU-Like N-Terminal Domain-Containing Protein; IscU Iron-Sulfur Cluster Scaffold Homolog; Iron-Sulfur Cluster Assembly Enzyme ISCU

  • AA Sequence

    YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK

  • Predicted Molecular Mass

    14.4 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 10% glycerol, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00