2. Recombinant Proteins
  3. Others
  4. ISCU Protein, Human (Baculovirus, His-Myc)

ISCU Protein, Human (Baculovirus, His-Myc)

Cat. No.: HY-P72066
Handling Instructions

ISCU is an important mitochondrial scaffolding protein in the ISC assembly complex and forms the structural basis of [2Fe-2S] cluster assembly. ISCU relies on FXN to centrally receive persulfide during de novo synthesis initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1). ISCU Protein, Human (Baculovirus, His-Myc) is the recombinant human-derived ISCU protein, expressed by Sf9 insect cells , with N-10*His, C-Myc labeled tag. The total length of ISCU Protein, Human (Baculovirus, His-Myc) is 133 a.a., with molecular weight of ~18.3 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ISCU is an important mitochondrial scaffolding protein in the ISC assembly complex and forms the structural basis of [2Fe-2S] cluster assembly. ISCU relies on FXN to centrally receive persulfide during de novo synthesis initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1). ISCU Protein, Human (Baculovirus, His-Myc) is the recombinant human-derived ISCU protein, expressed by Sf9 insect cells , with N-10*His, C-Myc labeled tag. The total length of ISCU Protein, Human (Baculovirus, His-Myc) is 133 a.a., with molecular weight of ~18.3 kDa.
Background

ISCU, a pivotal mitochondrial scaffold protein within the core iron-sulfur cluster (ISC) assembly complex, serves as the structural foundation for the assembly of [2Fe-2S] clusters. In the intricate process of de novo synthesis of [2Fe-2S] clusters, initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1), ISCU plays a central role by receiving persulfide in a FXN-dependent manner. Stabilization of this complex is facilitated by FDX2, providing reducing equivalents for efficient [2Fe-2S] cluster assembly. Subsequently, ISCU acts as a crucial intermediary, transferring the assembled [2Fe-2S] cluster to chaperone proteins, including HSCB, HSPA9, and GLRX5. Notably, ISCU exhibits dynamic conformational states, alternating between structured (S) and disordered (D) forms. Its zinc-dependent modulation of NFS1 desulfurase activity and influence on the interaction between FXN and the cysteine desulfurase complex further underscore its multifaceted role. Additionally, as a cytoplasmic scaffold protein, ISCU contributes to the structural framework of the cytoplasmic ISC assembly complex, participating in the assembly of Fe-S clusters and potentially contributing to cytoplasmic iron-sulfur protein biogenesis.
Species

Human
Source

Sf9 insect cells
Tag

N-10*His;C-Myc
Accession

Q9H1K1 (Y35-K167)
Gene ID
Molecular Construction
N-term
10*His
ISCU (Y35-K167)
Accession # Q9H1K1
Myc
C-term
Synonyms
2310020H20Rik; HML; hnifU; Iron sulfur cluster assembly enzyme ISCU mitochondrial; Iron sulfur cluster scaffold homolog E. coli; ; Iron sulfur cluster scaffold homolog; Iron-sulfur cluster assembly enzyme ISCU; Iscu; IscU iron sulfur cluster scaffold homolog; ISCU_HUMAN; ISU2; MGC74517; mitochondrial; NIFU; NifU like N terminal domain containing; NifU like N terminal domain containing protein; NifU like protein; NifU-like N-terminal domain-containing protein; NifU-like protein; NIFUN; Nitrogen fixation cluster like; OTTHUMP00000238760; OTTHUMP00000238761; OTTHUMP00000238762; OTTHUMP00000238764; OTTHUMP00000238765
AA Sequence

YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK

Molecular Weight

Approximately 18.3 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

ISCU Protein, Human (Baculovirus, His-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ISCU Protein, Human (Baculovirus, His-Myc)
Cat. No.:
HY-P72066
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.