1. Recombinant Proteins
  2. Others
  3. ITGBL1 Protein, Human (Myc, His)

Integrin beta-like protein 1 (ITGBL1) is a beta integrin-related protein that is a member of the EGF-like protein family, containing integrin-like cysteine-rich repeats and may has integrin binding activity. ITGBL1 might be involved in cell adhesion mediated by integrin; cell-matrix adhesion; and integrin-mediated signaling pathway. ITGBL1 Protein, Human (Myc, His) is the recombinant human-derived ITGBL1 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Integrin beta-like protein 1 (ITGBL1) is a beta integrin-related protein that is a member of the EGF-like protein family, containing integrin-like cysteine-rich repeats and may has integrin binding activity. ITGBL1 might be involved in cell adhesion mediated by integrin; cell-matrix adhesion; and integrin-mediated signaling pathway. ITGBL1 Protein, Human (Myc, His) is the recombinant human-derived ITGBL1 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

Background

Integrin beta-like protein 1 (ITGBL1) is a beta integrin-related protein that is a member of the EGF-like protein family. ITGBL1 contains integrin-like cysteine-rich repeats and may has integrin binding activity. ITGBL1 might be involved in cell adhesion mediated by integrin; cell-matrix adhesion; and integrin-mediated signaling pathway. ITGBL1 is predicted to be located in extracellular region; part of integrin complex; and active in cell surface and focal adhesion. Alternative splicing of ITGBL1 gene results in multiple transcript variants[1][2].

Species

Human

Source

E. coli

Tag

C-Myc;N-10*His

Accession

O95965 (V24-P494)

Gene ID
Molecular Construction
N-term
10*His
ITGBL1 (V24-P494)
Accession # O95965
Myc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
ITGBL1; OSCP; TIED; Integrin beta-like protein 1; Osteoblast-specific cysteine-rich protein; Ten integrin EGF-like repeat domain-containing protein
AA Sequence

VPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGAALCHGRGRCDCGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQGWYGDACQYPTNCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP

Molecular Weight

Approximately 67 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of solution in10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ITGBL1 Protein, Human (Myc, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ITGBL1 Protein, Human (Myc, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ITGBL1 Protein, Human (Myc, His)
Cat. No.:
HY-P71448
Quantity:
MCE Japan Authorized Agent: