JMJD1C Protein, Human (His-SUMO-Myc)

The JMJD1C protein is a possible histone demethylase that centrally affects the histone code by targeting “Lys-9” of histone H3. Its enzymatic activity produces formaldehyde and succinic acid. JMJD1C Protein, Human (His-SUMO-Myc) is the recombinant human-derived JMJD1C protein, expressed by E. coli , with C-Myc, N-SUMO, N-10*His labeled tag. The total length of JMJD1C Protein, Human (His-SUMO-Myc) is 225 a.a., with molecular weight of ~45.5 kDa.

The JMJD1C protein is identified as a probable histone demethylase with a specific role in demethylating 'Lys-9' of histone H3, thereby exerting a central influence on the histone code. This demethylase activity results in the generation of formaldehyde and succinate. Beyond its enzymatic function, JMJD1C is implicated in potential involvement in hormone-dependent transcriptional activation, suggested by its participation in the recruitment to androgen-receptor target genes. This multifaceted role underscores JMJD1C's significance in epigenetic regulation and its potential contribution to the dynamic interplay of histone modifications in the context of gene expression.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

C-Myc;N-SUMO;N-10*His

Q15652 (2274M-2498R)

221037  [NCBI]

MPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR

Approximately 45.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.