Kallikrein-1 Protein, Mouse (HEK293, His)
Kallikrein-1 protein is a member of the glandular kallikrein family and plays a vital role in enzyme activity by cleaving the Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin..This proteolysis is critical for the production of bradykinin, a bioactive peptide involved in multiple physiological processes, including blood pressure regulation, inflammation, and vascular permeability.Kallikrein-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Kallikrein-1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Kallikrein-1 protein is a member of the glandular kallikrein family and plays a vital role in enzyme activity by cleaving the Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin..This proteolysis is critical for the production of bradykinin, a bioactive peptide involved in multiple physiological processes, including blood pressure regulation, inflammation, and vascular permeability.Kallikrein-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Kallikrein-1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Kallikrein-1 is a protein belonging to the glandular kallikrein family, and it exhibits proteolytic activity by cleaving Met-Lys and Arg-Ser bonds in kininogen, leading to the release of Lys-bradykinin. This enzymatic activity positions Kallikrein-1 as a key player in the kinin-kallikrein system, a complex pathway involved in the regulation of blood pressure, inflammation, and vascular permeability. By generating Lys-bradykinin, Kallikrein-1 contributes to the production of bradykinin, a potent vasoactive peptide with various physiological effects.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
P15947 (P19-D261)
-
Molecular Construction
-
N-term
-
Kallikrein-1 (P19-D261)
Accession # P15947 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein (with Propeptide)
-
Synonyms
KLK1; Kallikrein 1, Renal/Pancreas/Salivary, Isoform CRA_c; Kallikrein 1; Kallikrein 1, Renal/Pancreas/Salivary, Isoform CRA_a; Klk6; Kallikrein 1 Isoform 3 Preproprotein; Kidney/Pancreas/Salivary Gland Kallikrein; Kallikrein Serine Protease 1; Kallikrein
-
AA Sequence
PPVQSRIVGGFNCEKNSQPWQVAVYRFTKYQCGGILLNANWVLTAAHCHNDKYQVWLGKNNFLEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVKYEYPDELQCVNLKLLPNEDCAKAHIEKVTDDMLCAGDMDGGKDTCAGDSGGPLICDGVLQGITSWGPSPCGKPNVPGIYTRVLNFNTWIRETMAEND
-
Predicted Molecular Mass
27.9 kDa
-
Molecular Weight
Approximately 34-38 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
