1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Kallikrein-14 Protein, Mouse (His)

Kallikrein-14 Protein, Mouse (His)

Cat. No.: HY-P71590
SDS COA Handling Instructions

Kallikrein-14 protein is a serine-type endopeptidase with multiple substrate specificities and has trypsin-like and chymotrypsin-like activities. It activates/inactivates protease-activated receptors (F2R, F2RL1, F2RL3) and other kallikreins (KLK1, KLK3, KLK5, KLK11). Kallikrein-14 Protein, Mouse (His) is the recombinant mouse-derived Kallikrein-14 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg $100 In-stock
10 μg $170 In-stock
50 μg $480 Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Kallikrein-14 protein is a serine-type endopeptidase with multiple substrate specificities and has trypsin-like and chymotrypsin-like activities. It activates/inactivates protease-activated receptors (F2R, F2RL1, F2RL3) and other kallikreins (KLK1, KLK3, KLK5, KLK11). Kallikrein-14 Protein, Mouse (His) is the recombinant mouse-derived Kallikrein-14 protein, expressed by E. coli , with N-His labeled tag.

Background

Kallikrein-14, a serine-type endopeptidase, exhibits a versatile substrate specificity with both trypsin-like and chymotrypsin-like activities. This protease is implicated in the activation or inactivation of various proteinase-activated receptors, including F2R, F2RL1, and F2RL3, as well as other kallikreins such as KLK1, KLK3, KLK5, and KLK11. It plays a crucial role in seminal clot liquefaction through the direct cleavage of semenogelins SEMG1 and SEMG2, leading to the activation of KLK3. Additionally, Kallikrein-14 is involved in epidermal desquamation by cleaving desmoglein DSG1, contributing to the shedding of superficial corneocytes from the skin surface. Its engagement in tumor progression encompasses roles in growth, invasion, and angiogenesis. Notably, Kallikrein-14 is subject to inhibition by various serine protease inhibitors, including SERPINA1, SERPINC1, SERPINE1, and SERPINF2, as well as aprotinin, soybean trypsin inhibitor, and leupeptin. Its autoproteolytic activity may have regulatory implications, and the enzyme's activation is facilitated by citrate while being inhibited by zinc and, to a lesser extent, manganese.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Mouse

Source

E. coli

Tag

N-His

Accession

Q8CGR5 (I24-N250)

Gene ID
Molecular Construction
N-term
His
Kallikrein-14 (I24-N250)
Accession # Q8CGR5
C-term
Synonyms
Klk14; Gk14Kallikrein-14; EC 3.4.21.-; Glandular kallikrein KLK14; mGK14; Kallikrein related-peptidase 14
AA Sequence

IIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAAHCARPILHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKVRLGRAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQACHRAYPGIITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWIQRTMQSN

Molecular Weight

Approximately 28.5 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Kallikrein-14 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Kallikrein-14 Protein, Mouse (His)
Cat. No.:
HY-P71590
Quantity:
MCE Japan Authorized Agent: