1. Protéines recombinantes
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Kallikrein-3/PSA Protein, Human (244a.a, HEK293, His)

Kallikrein-3 (PSA) protein, pivotal in the male reproductive system, hydrolyzes semenogelin-1, a seminal vesicle protein. This enzymatic activity initiates seminal coagulum liquefaction, crucial for sperm mobility and fertility. PSA's cleavage of semenogelin-1 highlights its importance in the complex processes of semen physiology and male reproductive function. Kallikrein-3/PSA Protein, Human (244a.a, HEK293, His) is the recombinant human-derived Kallikrein-3/PSA protein, expressed by HEK293 , with C-His labeled tag.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Prix Stock Quantité
Échantillon gratuit   Apply now
Échantillon gratuit   Apply now
5 μg En stock
10 μg En stock
50 μg En stock
100 μg En stock
> 100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Kallikrein-3/PSA Protein, Human (244a.a, HEK293, His)

  • Activité biologique

  • Paramètres Techniques

  • Propriétés

  • Description

Description

Kallikrein-3 (PSA) protein, pivotal in the male reproductive system, hydrolyzes semenogelin-1, a seminal vesicle protein. This enzymatic activity initiates seminal coagulum liquefaction, crucial for sperm mobility and fertility. PSA's cleavage of semenogelin-1 highlights its importance in the complex processes of semen physiology and male reproductive function. Kallikrein-3/PSA Protein, Human (244a.a, HEK293, His) is the recombinant human-derived Kallikrein-3/PSA protein, expressed by HEK293 , with C-His labeled tag.

Background

Kallikrein-3 (PSA) protein plays a pivotal role in the male reproductive system by hydrolyzing semenogelin-1, a seminal vesicle protein. This enzymatic activity is responsible for initiating the liquefaction of the seminal coagulum, a critical step in sperm mobility and overall fertility. PSA's ability to cleave semenogelin-1 underscores its significance in the intricate processes involved in semen physiology and male reproductive function.

Activité biologique

Measured by its ability to cleave the colorimetric peptide 1 mM substrate, Succinyl-Arg-Pro-Tyr-p-Nitroanilide.The specific activity is 83.09 pmol/min/µg. (Activation description: The proenzyme needs to be activated by Thermolysin for an activated form.)

Species

Human

Source

HEK293

Tag

C-His

Accession

P07288 (A18-P261)

Gene ID

354  [NCBI]

Molecular Construction
N-term
PSA (A18-P261)
Accession # P07288
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuProstate-specific antigen/KLK3, His; Prostate-Specific Antigen; PSA; Gamma-Seminoprotein; Seminin; Kallikrein-3; P-30 Antigen; Semenogelase; KLK3; APS
AA Sequence

APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

Masse moléculaire

30-35 kDa

Glycosylation
Yes
Structure/Form
Pro-form
Pureté
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM MES, 150 mM NaCl, 2 mM CaCl2, pH 6.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Livraison

Room temperature in continental US; may vary elsewhere.

Documentation

Kallikrein-3/PSA Protein, Human (244a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

Kallikrein-3/PSA Protein, Human (244a.a, HEK293, His)

 

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

     

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
Kallikrein-3/PSA Protein, Human (244a.a, HEK293, His)
Cat. No.:
HY-P70266
Quantité:
MCE Japan Authorized Agent: