1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Kallikrein-3/PSA Protein, Human (244a.a, HEK293, His)

Kallikrein-3/PSA Protein, Human (244a.a, HEK293, His)

Cat. No.: HY-P70266
COA Handling Instructions

Kallikrein-3 (PSA) protein, pivotal in the male reproductive system, hydrolyzes semenogelin-1, a seminal vesicle protein. This enzymatic activity initiates seminal coagulum liquefaction, crucial for sperm mobility and fertility. PSA's cleavage of semenogelin-1 highlights its importance in the complex processes of semen physiology and male reproductive function. Kallikrein-3/PSA Protein, Human (244a.a, HEK293, His) is the recombinant human-derived Kallikrein-3/PSA protein, expressed by HEK293 , with C-His labeled tag. The total length of Kallikrein-3/PSA Protein, Human (244a.a, HEK293, His) is 244 a.a., with molecular weight of 30-35 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg $155 In-stock
50 μg $430 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Kallikrein-3 (PSA) protein, pivotal in the male reproductive system, hydrolyzes semenogelin-1, a seminal vesicle protein. This enzymatic activity initiates seminal coagulum liquefaction, crucial for sperm mobility and fertility. PSA's cleavage of semenogelin-1 highlights its importance in the complex processes of semen physiology and male reproductive function. Kallikrein-3/PSA Protein, Human (244a.a, HEK293, His) is the recombinant human-derived Kallikrein-3/PSA protein, expressed by HEK293 , with C-His labeled tag. The total length of Kallikrein-3/PSA Protein, Human (244a.a, HEK293, His) is 244 a.a., with molecular weight of 30-35 kDa.

Background

Kallikrein-3 (PSA) protein plays a pivotal role in the male reproductive system by hydrolyzing semenogelin-1, a seminal vesicle protein. This enzymatic activity is responsible for initiating the liquefaction of the seminal coagulum, a critical step in sperm mobility and overall fertility. PSA's ability to cleave semenogelin-1 underscores its significance in the intricate processes involved in semen physiology and male reproductive function.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-His

Accession

P07288 (A18-P261)

Gene ID

354  [NCBI]

Molecular Construction
N-term
PSA (A18-P261)
Accession # P07288
His
C-term
Synonyms
rHuProstate-specific antigen/KLK3, His; Prostate-Specific Antigen; PSA; Gamma-Seminoprotein; Seminin; Kallikrein-3; P-30 Antigen; Semenogelase; KLK3; APS
AA Sequence

APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

Molecular Weight

30-35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM MES, 150 mM NaCl, 2 mM CaCl2, pH 6.0 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Kallikrein-3/PSA Protein, Human (244a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Kallikrein-3/PSA Protein, Human (244a.a, HEK293, His)
Cat. No.:
HY-P70266
Quantity:
MCE Japan Authorized Agent: