1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Kallikrein-8 Protein, Human (HEK293, His)

Kallikrein-8 protein is a serine protease that degrades proteins such as casein, fibrinogen, kininogen, fibronectin, and type IV collagen. It cleaves L1CAM in response to neural activity, promoting neurite growth in hippocampal neurons. Kallikrein-8 Protein, Human (HEK293, His) is the recombinant human-derived Kallikrein-8 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Kallikrein-8 protein is a serine protease that degrades proteins such as casein, fibrinogen, kininogen, fibronectin, and type IV collagen. It cleaves L1CAM in response to neural activity, promoting neurite growth in hippocampal neurons. Kallikrein-8 Protein, Human (HEK293, His) is the recombinant human-derived Kallikrein-8 protein, expressed by HEK293 , with C-His labeled tag.

Background

Kallikrein-8 Protein is a serine protease known for its ability to degrade various proteins including casein, fibrinogen, kininogen, fibronectin, and collagen type IV. It also cleaves L1CAM in response to heightened neural activity, leading to neurite outgrowth and fasciculation in cultured hippocampal neurons. This protein plays a crucial role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, thereby regulating Schaffer-collateral long-term potentiation in the hippocampus and contributing to memory acquisition and synaptic plasticity. Additionally, Kallikrein-8 is involved in skin desquamation, keratinocyte proliferation, and plays a role in the secondary phase of pathogenesis following spinal cord injury.

Biological Activity

Measured by its ability to cleave the fluorogenic peptide substrate BocVPRAMC. The specific activity is > 400pmol/min/μg. (Activation description: The proenzyme needs to be activated by Lysyl endopeptidase for an activated form.)

Species

Human

Source

HEK293

Tag

C-His

Accession

O60259-1 (Q29-G260)

Gene ID
Molecular Construction
N-term
Kallikrein-8 (Q29-G26)
Accession # O6259-1
His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein (with Propeptide)

Synonyms
Kallikrein-8; hK8; Neuropsin; Ovasin; TADG-14; NRPN; PRSS19
AA Sequence

QEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG

Molecular Weight

Approximately 36 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Kallikrein-8 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Kallikrein-8 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Kallikrein-8 Protein, Human (HEK293, His)
Cat. No.:
HY-P73265
Quantity:
MCE Japan Authorized Agent: