2. Recombinant Proteins
  3. Enzymes & Regulators
  4. Oxidoreductases (EC 1)
  5. KDM3B Protein, Human (Myc, His-SUMO)

KDM3B protein is a histone demethylase that mainly targets "Lys-9" of histone H3, catalyzes demethylation and produces formaldehyde and succinic acid by-products. In addition to histone modifications, KDM3B has been implicated in tumor suppressor activity, indicating its importance in cellular processes, gene expression regulation, and epigenetic modifications. KDM3B Protein, Human (Myc, His-SUMO) is the recombinant human-derived KDM3B protein, expressed by E. coli , with C-Myc, N-SUMO, N-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

KDM3B protein is a histone demethylase that mainly targets "Lys-9" of histone H3, catalyzes demethylation and produces formaldehyde and succinic acid by-products. In addition to histone modifications, KDM3B has been implicated in tumor suppressor activity, indicating its importance in cellular processes, gene expression regulation, and epigenetic modifications. KDM3B Protein, Human (Myc, His-SUMO) is the recombinant human-derived KDM3B protein, expressed by E. coli , with C-Myc, N-SUMO, N-His labeled tag.
Background

KDM3B Protein, a histone demethylase, occupies a pivotal role in the histone code by specifically targeting 'Lys-9' of histone H3. Its demethylase activity catalyzes the removal of methyl groups from this residue, generating formaldehyde and succinate as byproducts. Beyond its involvement in histone modification, KDM3B exhibits the potential for tumor suppressor activity, hinting at its significance in cellular processes related to the regulation of gene expression and epigenetic modifications. The specific demethylation function of KDM3B underscores its central role in shaping the dynamic landscape of histone modifications and its potential implications in cellular homeostasis and disease.
Species

Human
Source

E. coli
Tag

C-Myc;N-SUMO;N-His
Accession

Q7LBC6-1 (M1498-R1721)
Gene ID
Molecular Construction
N-term
10*His-SUMO
KDM3B (M1498-R1721)
Accession # Q7LBC6-1
C-term
Protein Length

Partial
Synonyms
5qNCA; C5orf7; JHDM2B; JmjC domain containing histone demethylation protein 2B; JmjC domain-containing histone demethylation protein 2B; jmjd1b; Jumonji domain containing 1B; Jumonji domain containing protein 1B; Jumonji domain-containing protein 1B; KDM3B; KDM3B_HUMAN; KIAA1082; Lysine (K) specific demethylase 3B ; Lysine-specific demethylase 3B; NET22; Nuclear protein 5qNCA
AA Sequence

MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFR

Predicted Molecular Mass
45.6 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
각종 서류
Handling Instructions (2659 KB)

KDM3B Protein, Human (Myc, His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

KDM3B Protein, Human (Myc, His-SUMO)

  

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

도

Country or Region *

      

비고

대량구매 문의

Inquiry Information

상품명:
KDM3B Protein, Human (Myc, His-SUMO)
Cat. No.:
HY-P71585
수량:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

상품명

  

Lot #

고객명 *

 

Country or Region *

메일주소 *

     

전화번호 *

 

회사명 *

비고

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.