KDM3B Protein, Human (Myc, His-SUMO)
KDM3B protein is a histone demethylase that mainly targets "Lys-9" of histone H3, catalyzes demethylation and produces formaldehyde and succinic acid by-products. In addition to histone modifications, KDM3B has been implicated in tumor suppressor activity, indicating its importance in cellular processes, gene expression regulation, and epigenetic modifications. KDM3B Protein, Human (Myc, His-SUMO) is the recombinant human-derived KDM3B protein, expressed by E. coli , with C-Myc, N-SUMO, N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
KDM3B protein is a histone demethylase that mainly targets "Lys-9" of histone H3, catalyzes demethylation and produces formaldehyde and succinic acid by-products. In addition to histone modifications, KDM3B has been implicated in tumor suppressor activity, indicating its importance in cellular processes, gene expression regulation, and epigenetic modifications. KDM3B Protein, Human (Myc, His-SUMO) is the recombinant human-derived KDM3B protein, expressed by E. coli , with C-Myc, N-SUMO, N-His labeled tag.
Background
KDM3B Protein, a histone demethylase, occupies a pivotal role in the histone code by specifically targeting 'Lys-9' of histone H3. Its demethylase activity catalyzes the removal of methyl groups from this residue, generating formaldehyde and succinate as byproducts. Beyond its involvement in histone modification, KDM3B exhibits the potential for tumor suppressor activity, hinting at its significance in cellular processes related to the regulation of gene expression and epigenetic modifications. The specific demethylation function of KDM3B underscores its central role in shaping the dynamic landscape of histone modifications and its potential implications in cellular homeostasis and disease.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-Myc;N-SUMO;N-His
-
Accession
Q7LBC6-1 (M1498-R1721)
-
Molecular Construction
-
N-term
-
10*His-SUMO
-
KDM3B (M1498-R1721)
Accession # Q7LBC6-1 -
C-term
-
-
Protein Length
Full Length of JmjC Domain
-
Synonyms
KDM3B; Lysine (K)-Specific Demethylase 3B; Prev. C5orf7; Jumonji Domain Containing 1B; Prev. JMJD1B; Nuclear Protein 5qNCA; KIAA1082; Chromosome 5 Open Reading Frame 7; NET22; JHDM2B; JmjC Domain-Containing Histone Demethylation Protein 2B; 5qNCA; [Histon
-
AA Sequence
MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFR
-
Predicted Molecular Mass
45.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
