KGF/FGF-7 Protein, Human (CHO)

KGF/FGF-7 Protein, Human (CHO) is a polypeptide mitogen that belongs to the family of fibroblast growth factors, binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. KGF/FGF-7 Protein and its receptor are important for normal wound healing.

Keratinocyte growth factor 1 or FGF-7 is a polypeptide mitogen that belongs to the family of fibroblast growth factors, binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. FGF-7 and its receptor are believed to be important for normal wound healing^[1].

The ED₅₀ is <1 ng /mL as measured in a cell proliferation assay using 4MBr5 cells.

• 
  Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED₅₀ for this effect is 0.9698 ng/mL, corresponding to a specific activity is 1.031×10⁶ units/mg.

Human

CHO

Tag Free

P21781-1 (C32-T194)

2252  [NCBI]

Full Length of Isoform-1 Mature Protein

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Approximately 16-27, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Trowbridge JM, et al. Dermatan sulfate binds and potentiates activity of keratinocyte growth factor (FGF-7). J Biol Chem. 2002 Nov 8;277(45):42815-20.  [Content Brief]