KIR3DL2/CD158k Protein, Rhesus macaque (HEK293, His)

KIR3DL2/CD158k is expressed on NK and T cells and recognizes MHC class I, specifically the peptide-free open conformer of HLA-F. Binding to HLA-F negatively regulates NK and T cell effector functions, thereby complexly modulating immune responses. KIR3DL2/CD158k Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived KIR3DL2/CD158k protein, expressed by HEK293 , with C-His labeled tag.

KIR3DL2/CD158k, a receptor expressed on natural killer (NK) cells and T cells, plays a pivotal role in recognizing MHC class I molecules. Upon binding to the peptide-free HLA-F open conformer, KIR3DL2 exerts a negative regulatory influence on NK and T cell effector functions, contributing to the intricate modulation of immune responses. Beyond its immune cell role, KIR3DL2 also serves as a receptor on astrocytes for HLA-F, potentially safeguarding motor neurons from astrocyte-induced toxicity through interactions with HLA-F. This multifaceted engagement underscores the diverse functions of KIR3DL2 in both immune regulation and neural protection.

Rhesus Macaque

HEK293

C-His

F7GCU5 (H22-H338)

/

Partial

HVDGQDKPFLSAWPSAVVPQGEHVSLQCHSHLGFTIFSLYKEDGVPAPELYNRRFWKDILLGPVTPAHAGTYRCRGSHLHSPTEWSAPSNPLVITVTGVYRKPSLLAHPGPLVKSGEMVVLQCWSDMRFEHFLLHREGITEDPLHLTGQLHDGGSQANSSVGPMIPALAGTYRCFGSVAYSPYEWSAPSDPLDIVIIGVYGKPSLSAQPGPTVQAGENVTLSCSSQSSFDIYRLSRDGEAHGLRLPAVPRVSGTFKADFPLGPATHGGNYRCFGSFRALPYVWSHPSDPLPISVTGNSSSTWSSPTEPSSNTGIPRH

Approximately 50-60 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.