1. Recombinant Proteins
  2. Others
  3. KIR3DL2/CD158k Protein, Rhesus macaque (HEK293, His)

KIR3DL2/CD158k Protein, Rhesus macaque (HEK293, His)

Cat. No.: HY-P700771
Handling Instructions Technical Support

KIR3DL2/CD158k is expressed on NK and T cells and recognizes MHC class I, specifically the peptide-free open conformer of HLA-F. Binding to HLA-F negatively regulates NK and T cell effector functions, thereby complexly modulating immune responses. KIR3DL2/CD158k Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived KIR3DL2/CD158k protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KIR3DL2/CD158k is expressed on NK and T cells and recognizes MHC class I, specifically the peptide-free open conformer of HLA-F. Binding to HLA-F negatively regulates NK and T cell effector functions, thereby complexly modulating immune responses. KIR3DL2/CD158k Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived KIR3DL2/CD158k protein, expressed by HEK293 , with C-His labeled tag.

Background

KIR3DL2/CD158k, a receptor expressed on natural killer (NK) cells and T cells, plays a pivotal role in recognizing MHC class I molecules. Upon binding to the peptide-free HLA-F open conformer, KIR3DL2 exerts a negative regulatory influence on NK and T cell effector functions, contributing to the intricate modulation of immune responses. Beyond its immune cell role, KIR3DL2 also serves as a receptor on astrocytes for HLA-F, potentially safeguarding motor neurons from astrocyte-induced toxicity through interactions with HLA-F. This multifaceted engagement underscores the diverse functions of KIR3DL2 in both immune regulation and neural protection.

Species

Rhesus Macaque

Source

HEK293

Tag

C-His

Accession

F7GCU5 (H22-H338)

Gene ID

/

Molecular Construction
N-term
CD158k (H22-H338)
Accession # F7GCU5
His
C-term
Protein Length

Partial

Synonyms
NKAT-4; NKAT4; CD158k; CL-5; KIR3DL2; NKAT4A; NKAT4B; p140
AA Sequence

HVDGQDKPFLSAWPSAVVPQGEHVSLQCHSHLGFTIFSLYKEDGVPAPELYNRRFWKDILLGPVTPAHAGTYRCRGSHLHSPTEWSAPSNPLVITVTGVYRKPSLLAHPGPLVKSGEMVVLQCWSDMRFEHFLLHREGITEDPLHLTGQLHDGGSQANSSVGPMIPALAGTYRCFGSVAYSPYEWSAPSDPLDIVIIGVYGKPSLSAQPGPTVQAGENVTLSCSSQSSFDIYRLSRDGEAHGLRLPAVPRVSGTFKADFPLGPATHGGNYRCFGSFRALPYVWSHPSDPLPISVTGNSSSTWSSPTEPSSNTGIPRH

Predicted Molecular Mass
35.4 kDa
Molecular Weight

Approximately 50-60 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

KIR3DL2/CD158k Protein, Rhesus macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

KIR3DL2/CD158k Protein, Rhesus macaque (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KIR3DL2/CD158k Protein, Rhesus macaque (HEK293, His)
Cat. No.:
HY-P700771
Quantity:
MCE Japan Authorized Agent: