Ku70-Ku80 Heterodimer Protein, Human (sf9, His)

Ku70 is a single-stranded DNA-dependent ATP-dependent helicase that plays a key role in DNA nonhomologous end joining (NHEJ) and is central to double-strand break repair and V(D)J recombination. As a DNA helicase II complex, it has a cell cycle-dependent preference for double-stranded DNA fork ends in the 3'-5' direction, recognizing and binding to broken DNA ends during NHEJ, protecting them from resection. Ku70-Ku80 Heterodimer Protein, Human (sf9, His) is a recombinant protein dimer complex containing human-derived Ku70-Ku80 Heterodimer protein, expressed by Sf9 insect cells , with N-His labeled tag. Ku70-Ku80 Heterodimer Protein, Human (sf9, His), has molecular weight of ~70 & 85 kDa, respectively.

The Ku70 is a single-stranded DNA-dependent ATP-dependent helicase crucial for DNA non-homologous end joining (NHEJ), playing a central role in double-strand break repair and V(D)J recombination. Functioning as a DNA helicase II complex, it exhibits a cell cycle-dependent preference for fork-like ends of double-stranded DNA and operates in the 3'-5' direction. During NHEJ, the heterodimer recognizes and binds to broken DNA ends, protecting them from further resection. It acts as a regulatory subunit of the DNA-dependent protein kinase complex (DNA-PK), significantly enhancing the catalytic subunit PRKDC's affinity to DNA. The Ku70 is implicated in stabilizing broken DNA ends and bringing them together for the subsequent ligation step in NHEJ. Additionally, it may serve as a 5'-deoxyribose-5-phosphate lyase (5'-dRP lyase), facilitating the elimination of 5' deoxyribose-5-phosphate at abasic sites near double-strand breaks. Beyond its role in DNA repair, the heterodimer participates in the regulation of transcription, osteocalcin expression, and the early steps of ribosome assembly. It also forms complexes involved in the innate immune response and associates with various interacting partners, highlighting its multifaceted functions in cellular processes.

Human

Sf9 insect cells

N-His

P13010 (M1-I732)&P12956 (M1-D609)

7520  [NCBI]&2547  [NCBI]

Full Length

MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI

Approximately 70 kDa (XRCC5) & 85 kDa (XRCC6) , based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. /biology-dictionary/cho-cell.html  [Content Brief]