LACTB2 Protein, Human (GST)
As an endoribonuclease, LACTB2 protein preferentially cleaves the 3' purine-pyrimidine dinucleotide motif within single-stranded RNA, producing a cleavage product with a free 3'-OH group. It is worth noting that its enzymatic activity is only directed against single-stranded RNA and does not extend to double-stranded RNA or DNA. LACTB2 Protein, Human (GST) is the recombinant human-derived LACTB2 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
As an endoribonuclease, LACTB2 protein preferentially cleaves the 3' purine-pyrimidine dinucleotide motif within single-stranded RNA, producing a cleavage product with a free 3'-OH group. It is worth noting that its enzymatic activity is only directed against single-stranded RNA and does not extend to double-stranded RNA or DNA. LACTB2 Protein, Human (GST) is the recombinant human-derived LACTB2 protein, expressed by E. coli , with N-GST labeled tag.
Background
LACTB2 protein functions as an endoribonuclease, exhibiting a preference for cleaving single-stranded RNA at 3' to purine-pyrimidine dinucleotide motifs. The resulting cleavage product retains a free 3'-OH group. Notably, LACTB2 lacks activity with double-stranded RNA or DNA. Its role is essential for maintaining normal mitochondrial function and ensuring cell viability. The specific substrate preference and its involvement in RNA cleavage highlight LACTB2's significance in regulating RNA processing within the mitochondria, emphasizing its critical role in cellular and mitochondrial homeostasis. (
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
Q53H82 (M1-L288)
-
Molecular Construction
-
N-term
-
GST
-
LACTB2 (M1-L288)
Accession # Q53H82 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
LACTB2; Endoribonuclease LACTB2; Lactamase Beta 2; CGI-83; Beta-Lactamase-Like Protein 2; Testicular Secretory Protein Li 23
-
AA Sequence
MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL
-
Predicted Molecular Mass
59.2 kDa
-
Molecular Weight
Approximately 56 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)