LACTB2 Protein, Human (GST)

As an endoribonuclease, LACTB2 protein preferentially cleaves the 3' purine-pyrimidine dinucleotide motif within single-stranded RNA, producing a cleavage product with a free 3'-OH group. It is worth noting that its enzymatic activity is only directed against single-stranded RNA and does not extend to double-stranded RNA or DNA. LACTB2 Protein, Human (GST) is the recombinant human-derived LACTB2 protein, expressed by E. coli , with N-GST labeled tag. The total length of LACTB2 Protein, Human (GST) is 288 a.a., with molecular weight of ~56.0 kDa.

LACTB2 protein functions as an endoribonuclease, exhibiting a preference for cleaving single-stranded RNA at 3' to purine-pyrimidine dinucleotide motifs. The resulting cleavage product retains a free 3'-OH group. Notably, LACTB2 lacks activity with double-stranded RNA or DNA. Its role is essential for maintaining normal mitochondrial function and ensuring cell viability. The specific substrate preference and its involvement in RNA cleavage highlight LACTB2's significance in regulating RNA processing within the mitochondria, emphasizing its critical role in cellular and mitochondrial homeostasis. (

Human

E. coli

N-GST

Q53H82 (M1-L288)

51110  [NCBI]

MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL

Approximately 56.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.