1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens Biotinylated Proteins
  3. Inhibitory Checkpoint Molecules NK Cell CD Proteins Macrophage CD Proteins
  4. LAG-3 LAG-3/CD223
  5. LAG-3 Protein, Human (Biotinylated, HEK293, His-Avi)

LAG-3 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P72389
Handling Instructions

LAG-3 (lymphocyte activating gene 3) protein is an inhibitory receptor on antigen-activated T cells and is critical for immune regulation. LAG-3 binds to FGL1 and transmits inhibitory signals that negatively affect CD8(+) and CD4(+) T cell proliferation, activation, and effector functions. LAG-3 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LAG-3 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag. The total length of LAG-3 Protein, Human (Biotinylated, HEK293, His-Avi) is 428 a.a., with molecular weight of 60-70 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LAG-3 (lymphocyte activating gene 3) protein is an inhibitory receptor on antigen-activated T cells and is critical for immune regulation. LAG-3 binds to FGL1 and transmits inhibitory signals that negatively affect CD8(+) and CD4(+) T cell proliferation, activation, and effector functions. LAG-3 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LAG-3 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag. The total length of LAG-3 Protein, Human (Biotinylated, HEK293, His-Avi) is 428 a.a., with molecular weight of 60-70 kDa.

Background

LAG-3 (Lymphocyte activation gene 3) protein, an inhibitory receptor present on antigen-activated T-cells, plays a crucial role in immune regulation. Upon binding to its major ligand, FGL1, LAG-3 delivers inhibitory signals that negatively regulate the proliferation, activation, effector function, and homeostasis of both CD8(+) and CD4(+) T-cells. Acting in synergy with PDCD1/PD-1, LAG-3 may inhibit antigen-specific T-cell activation, particularly following T-cell receptor (TCR) engagement where it associates with CD3-TCR in the immunological synapse. Beyond its role in T-cell inhibition, LAG-3 is constitutively expressed on a subset of regulatory T-cells (Tregs), contributing to their suppressive function and mediating immune tolerance. Additionally, LAG-3 negatively regulates plasmacytoid dendritic cell (pDCs) activation and, intriguingly, interacts with MHC class II (MHC-II), potentially acting as both a ligand for MHC-II on antigen-presenting cells (APC) and a promoter of APC activation/maturation, thereby influencing Th1 immune response.

Species

Human

Source

HEK293

Tag

C-Avi;C-6*His

Accession

P18627 (L23-L450)

Gene ID
Molecular Construction
N-term
LAG-3 (L23-L450)
Accession # P18627
6*His-Avi
C-term
Synonyms
Lymphocyte activation gene 3 protein; Protein FDC; CD223
AA Sequence

LQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL

Molecular Weight

60-70 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LAG-3 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P72389
Quantity:
MCE Japan Authorized Agent: