LAG-3 Protein, Human (Biotinylated, HEK293, His-Avi)

LAG-3 (lymphocyte activating gene 3) protein is an inhibitory receptor on antigen-activated T cells and is critical for immune regulation. LAG-3 binds to FGL1 and transmits inhibitory signals that negatively affect CD8(+) and CD4(+) T cell proliferation, activation, and effector functions. LAG-3 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LAG-3 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

LAG-3 (Lymphocyte activation gene 3) protein, an inhibitory receptor present on antigen-activated T-cells, plays a crucial role in immune regulation. Upon binding to its major ligand, FGL1, LAG-3 delivers inhibitory signals that negatively regulate the proliferation, activation, effector function, and homeostasis of both CD8(+) and CD4(+) T-cells. Acting in synergy with PDCD1/PD-1, LAG-3 may inhibit antigen-specific T-cell activation, particularly following T-cell receptor (TCR) engagement where it associates with CD3-TCR in the immunological synapse. Beyond its role in T-cell inhibition, LAG-3 is constitutively expressed on a subset of regulatory T-cells (Tregs), contributing to their suppressive function and mediating immune tolerance. Additionally, LAG-3 negatively regulates plasmacytoid dendritic cell (pDCs) activation and, intriguingly, interacts with MHC class II (MHC-II), potentially acting as both a ligand for MHC-II on antigen-presenting cells (APC) and a promoter of APC activation/maturation, thereby influencing Th1 immune response.

Measured by its binding ability in a functional ELISA. Immobilized Biotinylated Human LAG-3, His,Avita at 1 μg/mL (100 μL/well) on streptavidin precoated (0.5 μg/well) plate can bind Monoclonal Anti-Human LAG3 Antibody, Human IgG1 with a linear range of 0.5-2 ng/mL.

Human

HEK293

C-Avi;C-6*His

P18627-1 (L23-L450)

3902  [NCBI]

Extracellular Domain

Biotin

The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

LQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL

Approximately 60-63 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 with 10% trehalose as protectant.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.