1. Recombinant Proteins
  2. Others
  3. Leukocidin-F subunit/LukF Protein, S. aureus (Myc, His-SUMO)

Leukocidin-F subunit/LukF Protein, S. aureus (Myc, His-SUMO)

Cat. No.: HY-P71454
COA Handling Instructions

Leukocidin-F subunit/LukF protein induces cytotoxic changes in polymorphonuclear leukocytes, while gamma-hemolysin, with components H-gamma-I and H-gamma-II identical to F, causes hemolysis in red blood cells. These proteins collectively contribute to pathogenic mechanisms by exerting cytotoxic effects on immune cells and inducing hemolysis in red blood cells. Leukocidin-F subunit/LukF Protein, S. aureus (Myc, His-SUMO) is the recombinant Staphylococcus aureus-derived Leukocidin-F subunit/LukF protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag. The total length of Leukocidin-F subunit/LukF Protein, S. aureus (Myc, His-SUMO) is 298 a.a., with molecular weight of ~54.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
20 μg $340 In-stock
50 μg $700 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Leukocidin-F subunit/LukF protein induces cytotoxic changes in polymorphonuclear leukocytes, while gamma-hemolysin, with components H-gamma-I and H-gamma-II identical to F, causes hemolysis in red blood cells. These proteins collectively contribute to pathogenic mechanisms by exerting cytotoxic effects on immune cells and inducing hemolysis in red blood cells. Leukocidin-F subunit/LukF Protein, S. aureus (Myc, His-SUMO) is the recombinant Staphylococcus aureus-derived Leukocidin-F subunit/LukF protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag. The total length of Leukocidin-F subunit/LukF Protein, S. aureus (Myc, His-SUMO) is 298 a.a., with molecular weight of ~54.0 kDa.

Background

The Leukocidin-F subunit/LukF protein induces cytotoxic changes in polymorphonuclear leukocytes, while the gamma-hemolysin causes hemolysis in red blood cells. Leukocidin is composed of two protein components: F and S. Additionally, gamma-hemolysin consists of two protein components, namely H-gamma-I, which is identical to F, and H-gamma-II. These proteins contribute to the overall pathogenic mechanisms by exerting cytotoxic effects on immune cells and causing hemolysis in red blood cells.

Species

Staphylococcus aureus

Source

E. coli

Tag

N-His;C-Myc;N-SUMO

Accession

P31715 (26A-323K)

Gene ID

/

Molecular Construction
N-term
10*His-SUMO
LukF (26A-323K)
Accession # P31715
Myc
C-term
Synonyms
lukF; Leukocidin-F subunit; Gamma-hemolysin; H-gamma-I subunit
AA Sequence

AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNAVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTLSRNTNYKNVGWGVEAHKIMNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDRAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK

Molecular Weight

Approximately 54.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in Tris-based buffer, 50% glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Leukocidin-F subunit/LukF Protein, S. aureus (Myc, His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Leukocidin-F subunit/LukF Protein, S. aureus (Myc, His-SUMO)
Cat. No.:
HY-P71454
Quantity:
MCE Japan Authorized Agent: