LIF Protein, Human (HEK293)

LIF protein induces terminal differentiation in leukemic cells, promoting hematopoietic and neuronal cell differentiation, and stimulating acute-phase protein synthesis in hepatocytes. Its diverse activities highlight its role in influencing cellular differentiation across various cell types and physiological contexts. LIF Protein, Human (HEK293) is the recombinant human-derived LIF protein, expressed by HEK293 , with tag free. The total length of LIF Protein, Human (HEK293) is 180 a.a., with molecular weight of 34-55 kDa.

The LIF protein possesses the capacity to induce terminal differentiation in leukemic cells. Its diverse range of activities encompasses the induction of hematopoietic differentiation in both normal and myeloid leukemia cells, prompting neuronal cell differentiation, and stimulating acute-phase protein synthesis in hepatocytes. These multifaceted activities underscore LIF's role in influencing cellular differentiation across various cell types and physiological contexts.

1. Measured by its ability to inhibit the proliferation of M1 mouse myeloid leukemia cells and the ED₅₀ is typically 0.2-0.8 ng/mL.
2. Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ this effect is ≤0.004637 ng/mL, corresponding to a specific activity is ≥2.157×10⁸ units/mg.
3.Immobilized Human LIF at 2 μg/mL (100 μl/Well) on the plate. Dose response curve for Human LIF R, hFc Tag with the EC₅₀ of ≤0.12 μg/mL determined by ELISA.

• 
  Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 0.004534 ng/mL, corresponding to a specific activity is 2.206×10⁸ units/mg.

Human

HEK293

Tag Free

P15018-1 (S23-F202)

3976  [NCBI]

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Approximately 24-55 kDa due to the glycosylation

Greater than 95% as determined by reducing SDS-PAGE or Tris-Bis PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM Tris, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.