LILRA5/CD85f Protein, Rat (HEK293, Fc)

The LILRA5/CD85f protein may trigger innate immune responses independently of recognition of MHC class I antigens. This unique feature suggests a unique role in early defense against pathogens, acting through a pathway that is independent of MHC class I antigen recognition. LILRA5/CD85f Protein, Rat (HEK293, Fc) is the recombinant rat-derived LILRA5/CD85f protein, expressed by HEK293 , with C-hFc labeled tag.

LILRA5/CD85f Protein is suggested to potentially play a role in triggering innate immune responses, indicating its involvement in the early defense mechanisms against pathogens. However, it does not appear to have a role in recognizing any class I major histocompatibility complex (MHC) antigens. This distinctive feature suggests that LILRA5/CD85f may exert its immune-modulating effects through pathways independent of class I MHC antigen recognition, highlighting its unique role in the intricate landscape of innate immune responses. The specific molecular mechanisms underlying its participation in triggering innate immunity remain to be fully elucidated, warranting further exploration into its functional significance in the context of the immune system.

Rat

HEK293

C-hFc

D4A6Y0 (Q17-N248)

691533  [NCBI]

Partial

QETSGLEGNPHKPTLSVQPGSLVARGKQVTILCEVTTGAQEYRLFKEGGPHPWRTKNTPKATNKAQFLISSIEQQHGGIYRCYYKTPSGWSEHSDPLELVVTGLYSKPSLSIQSSTVVTSGETVTLQCVSQLGFNRFVLTKEGEQKPSLIRDSEFINSTGQFQGLFPMGPVILSQRWMFRCYGYYVNSPQVWSEPSDLLEIHVSEAAQPLGLSPNISHPKTVSQHQDYTMEN

Approximately 63 kDa,based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.