1. Recombinant Proteins
  2. Receptor Proteins
  3. Leukocyte Immunoglobin-like Receptors
  4. LILRA6
  5. LILRA6/CD85b/ILT-8 Protein, Cynomolgus (HEK293, His)

LILRA6/CD85b/ILT-8 Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P700777
Handling Instructions Technical Support

LILRA6/CD85b/ILT-8 protein serves as a receptor for class I MHC antigens and plays a crucial role in immune recognition and regulation. Its interaction with class I MHC molecules has been shown to be involved in monitoring and potentially modulating immune responses. LILRA6/CD85b/ILT-8 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived LILRA6/CD85b/ILT-8 protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

LILRA6/CD85b/ILT-8 protein serves as a receptor for class I MHC antigens and plays a crucial role in immune recognition and regulation. Its interaction with class I MHC molecules has been shown to be involved in monitoring and potentially modulating immune responses. LILRA6/CD85b/ILT-8 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived LILRA6/CD85b/ILT-8 protein, expressed by HEK293 , with C-His labeled tag.

Background

LILRA6/CD85b/ILT-8 Protein appears to function as a receptor for class I MHC antigens, suggesting a pivotal role in immune recognition and regulation. Its ability to interact with class I MHC molecules indicates its involvement in monitoring and potentially modulating immune responses. As a receptor, LILRA6 may contribute to the precise recognition of cells presenting class I MHC antigens, thereby influencing immune activities. Further exploration of LILRA6's interactions and its impact on immune signaling could deepen our understanding of its role as a receptor and its potential implications in immune surveillance and regulatory mechanisms.

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

A0A2K5VN04 (G41-H474)

Gene ID

/

Molecular Construction
N-term
LILRA6 (G41-H474)
Accession # A0A2K5VN04
8*His
C-term
Protein Length

Extracellular Domain

Synonyms
7M1; CD85b; ILT8; LILRA6; Pira3
AA Sequence

GTLPKPTLWAEPGSVITQGSPVTLRCQGSLQVQEYHLYREKNPASWVRRIQRELVKKGYFPIASITSEHAGRYRCQYYSRNHSSELSEPLELVVTGAYSKPTLSALPSPVVASGGNVSLQCDSQVAFGGFILCKEGEDEHPQRLNSQSHARGWSWAVFSVVPVSPSRRWSYRCYGYDSRSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPVVAPGDKLTLQCGSDAGYYRFVLYKEGEREFLQRPGQQPQAGLSQANFTLGPVRVSHGGQYRCCGAHNLSSEWSAPSDPLDILISGQIRGRPFLSVQPSPKVVSGENVTLLCQSSWQFHAFLLTQAGAADAHLHLRSMHKYPKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLSVPSDPLELVVSGPSGGPSSPTTGPTSTCGPEDQPLNPTGSDPQSGLGRH

Predicted Molecular Mass
48.3 kDa
분자량

Approximately 68-75 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

LILRA6/CD85b/ILT-8 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

LILRA6/CD85b/ILT-8 Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
LILRA6/CD85b/ILT-8 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P700777
수량:
MCE Japan Authorized Agent: