1. Recombinant Proteins
  2. Receptor Proteins
  3. Leukocyte Immunoglobin-like Receptors
  4. Leukocyte Ig-Like Receptor B4
  5. LILRB4/CD85k/ILT3 Protein, Cynomolgus (HEK293, Fc)

LILRB4/CD85k/ILT3 Protein, Cynomolgus (HEK293, Fc)

Cat. No.: HY-P704249
Handling Instructions Technical Support

LILRB4/CD85k/ILT3 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived LILRB4/CD85k/ILT3 protein, expressed by HEK293, with C-hFc tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LILRB4/CD85k/ILT3 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived LILRB4/CD85k/ILT3 protein, expressed by HEK293, with C-hFc tag.

Background

LILRB4/CD85k/ILT3, an inhibitory receptor intricately involved in immune regulation, plays a crucial role in down-regulating immune responses. It serves as a receptor for FN1 and integrin ITGAV/ITGB3, exerting inhibitory effects on IgE-mediated mast cell activation and KITLG/SCF-mediated mast cell activation. Through its interaction with ITGAV/ITGB3, LILRB4/ILT3 further inhibits antibody production by memory and marginal zone B cells, likely by suppressing their differentiation into plasma cells. This multifaceted receptor extends its inhibitory influence to diverse immune functions, such as suppressing IFNG production by CD8 T cells, CD4 T cells, and natural killer cells, as well as inhibiting antigen presentation by dendritic cells to T cells, preventing T cell activation. Additionally, LILRB4/ILT3 effectively inhibits lipopolysaccharide-mediated neutrophil-dependent vascular injury and contributes to the suppression of the allergic inflammatory response by impeding the infiltration of neutrophils and eosinophils while preventing mast cell degranulation. Its interactions, particularly when tyrosine phosphorylated, with SH2 domain-containing phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 enhance the inhibition of mast cell activation.

Species

Cynomolgus

Source

HEK293

Tag

C-hFc

Accession

XP_015297198.1 (Q22-E259)

Gene ID

107128256

Molecular Construction
N-term
LILRB4 (Q22-E259)
Accession # XP_015297198.1
hFc
C-term
Protein Length

Partial

Synonyms
HM18; ILT3; ILT-3; LILRB4; LIR5; CD85K
AA Sequence

QAGPLPKPTVWAEPGSVISWGSPVTIWCQGTLDAQEYHLDKEGSPAPWDTQNPLEPRNKAKFSIPSMTQHYAGRYRCYYHSHPDWSEDSDPLDLVMTGAYSKPILSVLPSPLVTSGESVTLLCQSQSPMDTFLLFKEGAAHPLPRLRSQHGAQLHWAEFPMGPVTSVHGGTYRCISSRSFSHYLLSRPSDPVELTVLGSLESPSPSPTRSISAAAGPEDQSLMPTGSDPQSGLRRHWE

Predicted Molecular Mass
52.7 kDa
Molecular Weight

Approximately 60-66 kDa,based on SDS-PAGE under reducing conditions,120-140 kDa,based on SDS-PAGE under non-reduced conditions,due to the glycosylation.

Glycosylation
Yes
Structure/Form
Monomer
Purity

≥ 85%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of Tris with Glycine, Arginine and NaCl, pH7.5 with trehalose as protectant.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LILRB4/CD85k/ILT3 Protein, Cynomolgus (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

LILRB4/CD85k/ILT3 Protein, Cynomolgus (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LILRB4/CD85k/ILT3 Protein, Cynomolgus (HEK293, Fc)
Cat. No.:
HY-P704249
Quantity:
MCE Japan Authorized Agent: