1. Recombinant Proteins
  2. Others
  3. Lipocalin-2/NGAL Protein, Cynomolgus (HEK293, His)

Lipocalin-2/NGAL Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P701082
Handling Instructions Technical Support

Lipocalin-2/NGAL is a multifaceted iron transporter involved in multiple biological processes, including apoptosis, innate immunity, and kidney development. Lipocalin-2 dynamically affects cellular iron concentration through binding to the siderophore 2,3-dihydroxybenzoate. Lipocalin-2/NGAL Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Lipocalin-2/NGAL protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Lipocalin-2/NGAL is a multifaceted iron transporter involved in multiple biological processes, including apoptosis, innate immunity, and kidney development. Lipocalin-2 dynamically affects cellular iron concentration through binding to the siderophore 2,3-dihydroxybenzoate. Lipocalin-2/NGAL Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Lipocalin-2/NGAL protein, expressed by HEK293 , with C-His labeled tag.

Background

Lipocalin-2/NGAL, a multifaceted iron-trafficking protein, participates in diverse biological processes including apoptosis, innate immunity, and renal development. Through its association with the siderophore 2,3-dihydroxybenzoic acid (2,3-DHBA), Lipocalin-2 binds and shuttles iron, dynamically influencing cellular iron concentrations based on the holo-24p3 (iron-bound) or apo-24p3 (iron-free) forms. The interaction with the SLC22A17 receptor mediates iron release or chelation, finely regulating intracellular iron levels. In apoptosis triggered by interleukin-3 (IL3) deprivation, the iron-loaded form prevents apoptosis, while the iron-free form induces BCL2L11/BIM expression, leading to programmed cell death. Lipocalin-2 also contributes to innate immunity by sequestering bacterial siderophores, such as enterobactin, and exhibits the ability to bind siderophores from M. tuberculosis. Structurally, Lipocalin-2 exists as a monomer, homodimer (disulfide-linked), and forms a heterodimer (disulfide-linked) with MMP9. These diverse interactions underscore the versatility of Lipocalin-2 in orchestrating critical cellular and immune responses.

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

XP_005580845.2 (Q21-G198)

Gene ID

102137149

Molecular Construction
N-term
NGAL (Q21-G198)
Accession # XP_005580845.2
8*His
C-term
Protein Length

Partial

Synonyms
NGAL; Lipocalin-2; Oncogene 24p3; p25; Siderocalin LCN2; MSFI
AA Sequence

QDSSSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLSGNAVGRKDEAPLKMYATIYELKEDKSYNVTSILFRKEKCDYWIRTFVPGSQPGEFTLGNIQNHPGLTSYVVRVVSTNYKQYAMVFFKKVSQNKEYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFSVPIDQCIDG

Predicted Molecular Mass
21.5 kDa
Molecular Weight

Approximately 25-30 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Lipocalin-2/NGAL Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Lipocalin-2/NGAL Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Lipocalin-2/NGAL Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P701082
Quantity:
MCE Japan Authorized Agent: