LRG1 Protein, Cynomolgus (HEK293, His)

LRG1 is a member of the leucine-rich repeat sequence (LRR) family of proteins involved in protein-protein interactions, signal transduction, and cell adhesion and development. LRG1 is involved in promoting neovascularization by causing the switching of transforming growth factor β (TGF-β) signaling in endothelial cells. LRG1 is involved in ovarian cancer progression by activating the FAK/AKT signaling pathway. LRG1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived LRG1 protein, expressed by HEK293 , with C-His labeled tag.

LRG1 is a member of the leucine-rich repeat sequence (LRR) family of proteins involved in protein-protein interactions, signal transduction, and cell adhesion and development. LRG1 is involved in promoting neovascularization (new blood vessel growth) by causing the switching of transforming growth factor β (TGF-β) signaling in endothelial cells. LRG1 binds to the co-receptor endorphins and promotes signaling through the ALK1-Smad1/5/8 pathway. LRG1 is involved in ovarian cancer progression by activating the FAK/AKT signaling pathway^[1][2][3].

Immobilized Cynomolgus LRG1, His Tag at 5 μg/mL (100 μL/well) on the plate. Dose response curve for Anti-LRG1 Antibody, hFc Tag with the EC₅₀ of 0.09-1 μg/mL determined by ELISA.

Cynomolgus

HEK293

C-8*His

A0A2K5VVA4 (V72-Q383)

102118680

Cytoplasmic Domain

VTLSPKDCQVFRSDHGSSISCQPPAKIPSYLPADTVHLAVEFFNLTLLPATLLQGSSKLQELHLSSNRLESLSPEFLRPVPQLRVLDLTRNSLTGLPPGLFQASATLDTLVLKENQLEVLEASWLHGLKALRHLDLSGNCLRKLPPGLLANFTLLRTLDLAENQLETLPPDLLQGPLQLERLHLEGNKLQELGKDLLVLQPDLRYLFLNGNKLARVPAGAFQGLRQLDMLDLSNNSLASVPEGLWTSLGQPNRDMRDGFDISSNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAMKGQTLLAVAESQ

Approximately 50-60 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.