LRRC25 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The LRRC25 protein is an important regulator that inhibits RLR-mediated type I interferon signaling by coordinating the autophagic degradation of RIGI. Its specific interaction with ISG15-related RIGI promotes binding to p62/SQSTM1, leading to selective autophagic RIGI degradation. LRRC25 Protein, Human (HEK293, His) is the recombinant human-derived LRRC25 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The LRRC25 protein is an important regulator that inhibits RLR-mediated type I interferon signaling by coordinating the autophagic degradation of RIGI. Its specific interaction with ISG15-related RIGI promotes binding to p62/SQSTM1, leading to selective autophagic RIGI degradation. LRRC25 Protein, Human (HEK293, His) is the recombinant human-derived LRRC25 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
LRRC25 emerges as a crucial regulator in dampening RLR-mediated type I interferon signaling pathways, exerting its inhibitory influence by orchestrating the autophagic degradation of RIGI. The protein, through its specific interaction with ISG15-associated RIGI, facilitates the binding of RIGI to the autophagic cargo receptor p62/SQSTM1, leading to the selective autophagic degradation of RIGI. In addition to its role in immune modulation, LRRC25 plays a pivotal part in restraining the NF-kappa-B signaling pathway and mitigating inflammatory responses by fostering the degradation of p65/RELA. Notably, LRRC25 engages in direct interactions with RIGI, SQSTM1, and p65/RELA, underscoring its multifaceted involvement in orchestrating protein degradation processes and fine-tuning crucial cellular signaling cascades.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q8N386 (L21-T165)
-
Molecular Construction
-
N-term
-
LRRC25 (L21-T165)
Accession # Q8N386 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
LRRC25; FLJ38116; Leucine Rich Repeat Containing 25; Leucine Rich Repeat Containing 25, Isoform CRA_a; MAPA; Monocyte And Plasmacytoid Activated Molecule; Monocyte And Plasmacytoid-Activated Protein; LRRC25 Protein; Leucine-Rich Repeat-Containing Protein
-
AA Sequence
LEPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCALESWHDIRRDNCSGQKPLLCWDTTSSQHNLSAFLEVSCAPGLASAT
-
Predicted Molecular Mass
16.7 kDa
-
Molecular Weight
Approximately 20-40 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
