Lymphocyte antigen 6A-2/LY6A Protein, Mouse (His)

Lymphocyte antigen 6A-2/LY6A Protein, crucial for T-cell activation, plays a key role in immune responses. Its ability to facilitate T-cell activation underscores its importance in regulating T-cell responses and immune surveillance. The molecular interactions and signaling pathways in which LY6A participates during T-cell activation highlight its significance as a key orchestrator in immune responses, contributing to immune homeostasis. Lymphocyte antigen 6A-2/LY6A Protein, Mouse (His) is the recombinant mouse-derived Lymphocyte antigen 6A-2/LY6A protein, expressed by E. coli , with N-His labeled tag.

Lymphocyte antigen 6A-2/LY6A protein is characterized by its role in T-cell activation, signifying its involvement in pivotal immune responses. The protein's capacity to facilitate T-cell activation highlights its importance in mediating key events in the immune system, potentially contributing to the regulation of T-cell responses and immune surveillance. The specific molecular interactions and signaling pathways in which LY6A participates during T-cell activation underscore its significance as a key player in orchestrating immune responses and maintaining immune homeostasis.

Mouse

E. coli

N-His

P05533 (L27-G119)

110454  [NCBI]

Partial

LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNGGSTWTMAG

Approximately 10.9 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 0.2 M NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.