Lymphocyte antigen 6A-2/LY6A Protein, Mouse (His)
Based on 1 Customer Validation
Lymphocyte antigen 6A-2/LY6A Protein, crucial for T-cell activation, plays a key role in immune responses. Its ability to facilitate T-cell activation underscores its importance in regulating T-cell responses and immune surveillance. The molecular interactions and signaling pathways in which LY6A participates during T-cell activation highlight its significance as a key orchestrator in immune responses, contributing to immune homeostasis. Lymphocyte antigen 6A-2/LY6A Protein, Mouse (His) is the recombinant mouse-derived Lymphocyte antigen 6A-2/LY6A protein, expressed by E. coli , with N-His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Lymphocyte antigen 6A-2/LY6A Protein, crucial for T-cell activation, plays a key role in immune responses. Its ability to facilitate T-cell activation underscores its importance in regulating T-cell responses and immune surveillance. The molecular interactions and signaling pathways in which LY6A participates during T-cell activation highlight its significance as a key orchestrator in immune responses, contributing to immune homeostasis. Lymphocyte antigen 6A-2/LY6A Protein, Mouse (His) is the recombinant mouse-derived Lymphocyte antigen 6A-2/LY6A protein, expressed by E. coli , with N-His labeled tag.
Background
Lymphocyte antigen 6A-2/LY6A protein is characterized by its role in T-cell activation, signifying its involvement in pivotal immune responses. The protein's capacity to facilitate T-cell activation highlights its importance in mediating key events in the immune system, potentially contributing to the regulation of T-cell responses and immune surveillance. The specific molecular interactions and signaling pathways in which LY6A participates during T-cell activation underscore its significance as a key player in orchestrating immune responses and maintaining immune homeostasis.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-His
-
Accession
P05533 (L27-G119)
-
Gene ID110454 [NCBI]
-
Molecular Construction
-
N-term
-
His
-
LY6A (L27-G119)
Accession # P05533 -
C-term
-
-
Protein Length
Full Length of UPAR/Ly6 Domain
-
Synonyms
LY6S; LY6A; Lymphocyte Antigen 6 Family Member S; Lymphocyte Antigen 6S
-
AA Sequence
LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNGGSTWTMAG
-
Molecular Weight
Approximately 15-20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 0.2 M NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
