Lymphocyte antigen 6A-2/LY6A Protein, Mouse (His)

Customer Review

Based on 1 Customer Validation

Lymphocyte antigen 6A-2/LY6A Protein, crucial for T-cell activation, plays a key role in immune responses. Its ability to facilitate T-cell activation underscores its importance in regulating T-cell responses and immune surveillance. The molecular interactions and signaling pathways in which LY6A participates during T-cell activation highlight its significance as a key orchestrator in immune responses, contributing to immune homeostasis. Lymphocyte antigen 6A-2/LY6A Protein, Mouse (His) is the recombinant mouse-derived Lymphocyte antigen 6A-2/LY6A protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Lymphocyte antigen 6A-2/LY6A Protein, crucial for T-cell activation, plays a key role in immune responses. Its ability to facilitate T-cell activation underscores its importance in regulating T-cell responses and immune surveillance. The molecular interactions and signaling pathways in which LY6A participates during T-cell activation highlight its significance as a key orchestrator in immune responses, contributing to immune homeostasis. Lymphocyte antigen 6A-2/LY6A Protein, Mouse (His) is the recombinant mouse-derived Lymphocyte antigen 6A-2/LY6A protein, expressed by E. coli , with N-His labeled tag.

Background

Lymphocyte antigen 6A-2/LY6A protein is characterized by its role in T-cell activation, signifying its involvement in pivotal immune responses. The protein's capacity to facilitate T-cell activation highlights its importance in mediating key events in the immune system, potentially contributing to the regulation of T-cell responses and immune surveillance. The specific molecular interactions and signaling pathways in which LY6A participates during T-cell activation underscore its significance as a key player in orchestrating immune responses and maintaining immune homeostasis.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • LY6A (L27-G119)
      Accession # P05533
    • C-term
  • Protein Length

    Full Length of UPAR/Ly6 Domain

  • Synonyms

    LY6S; LY6A; Lymphocyte Antigen 6 Family Member S; Lymphocyte Antigen 6S

  • AA Sequence

    LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNGGSTWTMAG

  • Molecular Weight

    Approximately 15-20 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 0.2 M NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00