1. Recombinant Proteins
  2. Others
  3. Lymphocyte antigen 6E/LY6E Protein, Mouse (P.pastoris, His, SUMO)

Lymphocyte antigen 6E/LY6E Protein, Mouse (P.pastoris, His, SUMO)

Cat. No.: HY-P71830
Handling Instructions Technical Support

LY6E is a GPI-anchored cell surface protein that regulates T lymphocyte function by binding to CD3Z/CD247, affecting proliferation, differentiation and activation.It modulates T cell receptor signaling and exhibits antiviral activity against mouse hepatitis virus.Lymphocyte antigen 6E/LY6E Protein, Mouse (P.pastoris, His, SUMO) is the recombinant mouse-derived Lymphocyte antigen 6E/LY6E protein, expressed by P.pastoris , with N-His, N-SUMO labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
20 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

LY6E is a GPI-anchored cell surface protein that regulates T lymphocyte function by binding to CD3Z/CD247, affecting proliferation, differentiation and activation.It modulates T cell receptor signaling and exhibits antiviral activity against mouse hepatitis virus.Lymphocyte antigen 6E/LY6E Protein, Mouse (P.pastoris, His, SUMO) is the recombinant mouse-derived Lymphocyte antigen 6E/LY6E protein, expressed by P.pastoris , with N-His, N-SUMO labeled tag.

Background

LY6E, a glycosylphosphatidylinositol (GPI)-anchored cell surface protein, intricately governs T-lymphocyte functions, including proliferation, differentiation, and activation. It exerts its regulatory influence on T-cell receptor (TCR) signaling by engaging with the CD3Z/CD247 component at the plasma membrane, thereby modulating the phosphorylation of CD3Z/CD247. Beyond its role in immune response modulation, LY6E exhibits antiviral activity by impeding the entry of murine coronavirus, specifically mouse hepatitis virus, through interference with spike protein-mediated membrane fusion. Additionally, LY6E plays a pivotal role in placenta formation, acting as the primary receptor for syncytin-A (SynA), thus contributing to the proper morphogenesis of both fetal and maternal vasculatures within the placenta. Notably, LY6E may function as a modulator of nicotinic acetylcholine receptors (nAChRs) activity, demonstrated by its interaction with CHRNA4 and its inhibitory effect on alpha-3:beta-4-containing nAChRs in vitro.

Species

Mouse

Source

P. pastoris

Tag

N-His;N-SUMO

Accession

Q64253 (L27-A108)

Gene ID
Molecular Construction
N-term
6*His-SUMO
LY6E (L27-A108)
Accession # Q64253
C-term
Protein Length

Partial

Synonyms
Ly6e; Ly67; Sca-2; Tsa-1Lymphocyte antigen 6E; Ly-6E; Stem cell antigen 2; Thymic shared antigen 1; TSA-1
AA Sequence

LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA

Predicted Molecular Mass
24.8 kDa
분자량

Approximately 24 kDa

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

Lymphocyte antigen 6E/LY6E Protein, Mouse (P.pastoris, His, SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Lymphocyte antigen 6E/LY6E Protein, Mouse (P.pastoris, His, SUMO)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Lymphocyte antigen 6E/LY6E Protein, Mouse (P.pastoris, His, SUMO)
Cat. No.:
HY-P71830
수량:
MCE Japan Authorized Agent: