Major urinary protein 6 Protein, Mouse (His-SUMO)

Major Urinary Protein 6 (MUP6) is crucial in chemical communication, binding to pheromones in male urine. This interaction significantly influences female sexual behavior, regulating mating behaviors and contributing to chemical signaling in reproductive and social contexts. MUP6's specific binding to male-derived pheromones underscores its essential role in mediating these communication processes in the animal kingdom. Major urinary protein 6 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Major urinary protein 6 protein, expressed by E. coli, with N-His, N-SUMO labeled tag. The total length of Major urinary protein 6 Protein, Mouse (His-SUMO) is 180 a.a., with molecular weight of ~36.6 kDa.

The Major Urinary Protein 6 (MUP6) plays a pivotal role in chemical communication by binding to pheromones released from drying urine of males. This interaction with male-derived pheromones has a significant impact on the sexual behavior of females, influencing their responses and contributing to the regulation of mating behaviors. The ability of MUP6 to bind specifically to these pheromones underscores its essential role in mediating chemical signaling and communication within the context of reproductive and social behaviors in the animal kingdom.

Mouse

E. coli

N-His;N-SUMO

P02762 (1M-180E)

100038948  [NCBI]

MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Approximately 36.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.