Maleylacetoacetate isomerase/GSTZ1 Protein, Human (N-His)

The maleylacetoacetate isomerase/GSTZ1 protein is a member of the GST superfamily and detoxifies electrophilic molecules. It converts maleylacetoacetate to fumarylacetoacetate, a key step in phenylalanine/tyrosine degradation. Maleylacetoacetate isomerase/GSTZ1 Protein, Human (N-His) is the recombinant human-derived Maleylacetoacetate isomerase/GSTZ1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of Maleylacetoacetate isomerase/GSTZ1 Protein, Human (N-His) is 215 a.a., with molecular weight of ~25 kDa.

The Maleylacetoacetate isomerase/GSTZ1 protein belongs to the glutathione S-transferase (GSTs) superfamily, encoding multifunctional enzymes that play a crucial role in the detoxification of electrophilic molecules, including carcinogens, mutagens, and therapeutic drugs, through conjugation with glutathione. This enzyme specifically catalyzes the conversion of maleylacetoacetate to fumarylacetoacatate, a critical step in the phenylalanine/tyrosine degradation pathway. In mice, deficiency of a similar gene leads to oxidative stress. The gene exhibits several transcript variants that encode multiple protein isoforms. Furthermore, the Maleylacetoacetate isomerase/GSTZ1 protein displays broad expression in the liver (RPKM 23.8), testis (RPKM 10.9), and 24 other tissues.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

NP_665877.1 (Q2-A216)

2954  [NCBI]

QAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA

Approximately 25 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl,500 mM arginine, pH 7.4, 5% trehalose,5% mannitol and 0.01% Tween80.

Data is not available.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For lower concentration, please reconstitute in 50mM Tris-HCL,300mM NaCl,500mM arginine,pH 7.4 buffer.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.