Matrix protein 1/M1 Protein, H1N1 (NP_040978, His)

Matrix protein 1/M1 Protein is pivotal in virus replication, spanning entry, uncoating, assembly, and budding. Binding to ribonucleocapsids inhibits viral transcription, and interaction with NEP aids nuclear export. M1 forms a shell on the inner virion membrane, binding the RNP. During entry, M1 dissociates from the RNP, allowing nuclear transport for transcription. M1 influences virion shape, determining infectivity, with filamentous virions crucial for cell-to-cell spread and spherical virions for aerosol-based transmission. Matrix protein 1/M1 Protein, H1N1 (NP_040978, His) is the recombinant Virus-derived Matrix protein 1/M1 protein, expressed by E. coli , with N-His labeled tag.

Matrix protein 1 (M1) is integral to various stages of virus replication, playing essential roles from virus entry and uncoating to the assembly and budding of the virus particle. M1's binding to ribonucleocapsids (RNPs) in the nucleus is believed to inhibit viral transcription, and its interaction with viral NEP promotes the nuclear export of the complex, targeting it to the virion assembly site at the apical plasma membrane in polarized epithelial cells. Interactions with NA and HA potentially bring M1 into lipid rafts, despite it being a non-raft-associated protein. Within the virion, M1 forms a continuous shell on the inner side of the lipid bilayer, binding the RNP. During virus entry, the M2 ion channel acidifies the internal virion core, leading to M1 dissociation from the RNP. M1-free RNPs are then transported to the nucleus, allowing viral transcription and replication. Moreover, M1 determines the virion's shape, influencing whether it is spherical or filamentous. Clinical isolates of influenza often feature a significant proportion of filamentous virions, crucial for infecting neighboring cells, while spherical virions are better suited for aerosol-based spread between host organisms^[1][2].

Virus

E. coli

N-His

NP_040978 (S2-K252)

956527  [NCBI]

Full Length of Mature Protein

SLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK

Approximately 29 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM tris, 0.5 mM DTT, 0.5 mM EDTA, 5% glycerol, 50 mM NaCl, pH 7.6.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.